PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g062050.2.1
Common NameLOC101252101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family STAT
Protein Properties Length: 704aa    MW: 79468.8 Da    PI: 6.4034
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g062050.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT179.26.1e-562133331121
                STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipk 91 
                         +dv+l++ +++p++ + evvasL+y+d+ ++vek+ da+a LL+sydG+e++s+drp+k++ GrasfklkisqLsskcdnrLfri+f+ip+
  Solyc07g062050.2.1 213 IDVTLMDNFSRPMTEEAEVVASLVYSDDNTLVEKPVDADAALLTSYDGIEYASSDRPSKVISGRASFKLKISQLSSKCDNRLFRIRFDIPR 303
                         69***************************************************************************************** PP

                STAT  92 lkkypfleavskpirCisrsrntrsssltk 121
                         l kypfle++s+pirCisr+r+tr++sl+ 
  Solyc07g062050.2.1 304 LGKYPFLEVFSRPIRCISRNRSTRATSLML 333
                         ************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2001.6E-516156IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498999.01E-821135IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF555502.77E-6601668IPR000980SH2 domain
Gene3DG3DSA:3.30.505.107.1E-5601664IPR000980SH2 domain
PROSITE profilePS500019.529605703IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MGVKDYSFLR DLQVEFKNYE VTNKFSLCFW LYLNEPSTLP STILYQEHPD VTSHAPFLLL  60
DDRKKILLFP SLISSHSNIT SWREVAHAIS ESEFPTKKWV HVGCEVTQDL LHLYFDGKIV  120
GEKCLTSSLS NDMGSDNSRI SLTCITGKNS QLDGYVHSSE LFPMLSTIEN HYVKDPPVQL  180
SIDSSSAYEI EEDSDGVWSI VGGKASCRRN FDIDVTLMDN FSRPMTEEAE VVASLVYSDD  240
NTLVEKPVDA DAALLTSYDG IEYASSDRPS KVISGRASFK LKISQLSSKC DNRLFRIRFD  300
IPRLGKYPFL EVFSRPIRCI SRNRSTRATS LMLKKSSLGI HLLNGSQSPV LDDGSYDRPC  360
IVREAKQSPS SKRVKLGQEK LCANFKDDFV LKQANGGSRS HSWTSEDNHA HQNSLVARPV  420
SHGGAENFSS DSENSETTNS PVDDLPNNRD PISDMVVFKY CLADLNERRL LLKEMAMTAK  480
EEELATFAER VSLFSGCSHH RHQISISKRL IEEGINCWNL ISNYNHHVLW ENLVSGLQEH  540
FLKMTFGRIR SLTHQDFNLL RRVSGCQDLV SQDNFEKLWC WLYPVAFTLS QQCISSLWGS  600
TSPVWIEGFI TKEEAESSLT ILGALQEPGT YILRFPTSRS WPHPDAGNLV VTYVGSDYTI  660
HHRLISLESI YSSGVKGTTI RPIQDMLLEQ PELRRLGRIV RSL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.234170.0fruit| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g062050.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103540.0Solanum lycopersicum chromosome 7 clone C07HBa0102J11, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244305.10.0SH2 domain-containing protein A
TrEMBLA0A3Q7HGF00.0A0A3Q7HGF0_SOLLC; Uncharacterized protein
STRINGSolyc07g062050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Representative plantOGRP59411618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]