PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g052900.1.1
Common NameLOC101243904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GeBP
Protein Properties Length: 398aa    MW: 44075.4 Da    PI: 5.7162
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g052900.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573105.25.1e-33154245397
              DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelsk 93 
                         +++lws++D+++lL+G++++k+ +g++ps+d++af+ef++++++++vsksq+++K+rrL+kKf ++vk+   g+ep+f+k++d  +fe+sk
  Solyc07g052900.1.1 154 PRSLWSDDDQLALLKGILEYKTVKGMEPSADMSAFHEFIRGKLQAEVSKSQISDKVRRLRKKFLTNVKD---GEEPVFTKSQDFLVFEHSK 241
                         6789***************************************************************99...******************* PP

              DUF573  94 kiWg 97 
                         +iWg
  Solyc07g052900.1.1 242 RIWG 245
                         ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.3E-26156245IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MAPKTKSRLV DQPPSASSSE EQELVEESQE EEEQQSREEE GEEESGEETE EDEEPKTSHP  60
VVKRPISQKL VQTPQKPQFS SGSENGSGSD SEAESGSSLP SPSASAFTVK PNVAAKAAAS  120
SKATPKRPQE AQKEKGRKKP KVAEEEEKKS AATPRSLWSD DDQLALLKGI LEYKTVKGME  180
PSADMSAFHE FIRGKLQAEV SKSQISDKVR RLRKKFLTNV KDGEEPVFTK SQDFLVFEHS  240
KRIWGAPGAI NGGVKDNVNN SSNGKAKKSV EVRKISEPKR SAKVSKPKDD EKQKEEEKQI  300
AVKEVVKEDI VKGDQLDFQS KYPRLAASLE AMSGLSKMYP NGTSLLKEKM SLIATDKAKV  360
LEEKWKILED DEADLMVKRL DFIAEHYRLV VDAMRGN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.251700.0floral bud| flower| fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2535910.0Solanum lycopersicum strain Heinz 1706 chromosome 7 clone hba-13d24 map 7, complete sequence
GenBankAC2536110.0Solanum lycopersicum strain Heinz 1706 chromosome 7 clone slm-111k20 map 7, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004243436.10.0PREDICTED: neurofilament heavy polypeptide-like
TrEMBLK4CFI80.0K4CFI8_SOLLC; Uncharacterized protein
STRINGSolyc07g052900.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23692041
Representative plantOGRP1074824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.11e-24DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]