PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g052490.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 85aa    MW: 9634.7 Da    PI: 4.6562
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g052490.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.6e-083577145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++ ++++E+ l+++ + +   + W++Ia +++ gR + ++  +w 
  Solyc07g052490.2.1 35 KLEFSEDEEMLIAKMFSLVRER-WSLIAGRIP-GRNADEIEKYWK 77
                        678*****************99.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.6233084IPR017930Myb domain
SMARTSM007171.9E-53482IPR001005SANT/Myb domain
PfamPF002493.9E-73677IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-113778IPR009057Homeodomain-like
SuperFamilySSF466893.34E-73781IPR009057Homeodomain-like
CDDcd001676.67E-53777No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MADWNRSSTS DNASVVSPDS TRVVALETTN EETSKLEFSE DEEMLIAKMF SLVRERWSLI  60
AGRIPGRNAD EIEKYWKSKY SKSQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g052490.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001352307.12e-55MYB-like transcription factor ATV
TrEMBLA0A2H5AJN75e-54A0A2H5AJN7_SOLLC; MYB-like transcriptional factor MYBATV-X1 transcript variant 1
STRINGSolyc07g052490.2.12e-54(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA65791932
Representative plantOGRP3921825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.13e-15MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]