PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g049640.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 105aa    MW: 12211.2 Da    PI: 7.5594
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g049640.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.81.6e-252373151
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                        kpr rWt eLHe Fv+av++LGG+  AtPk+i++lm+ +++t eh+kSHLQ
  Solyc07g049640.2.1 23 KPRFRWTVELHEMFVKAVNELGGPYDATPKNIVKLMDDEDITPEHIKSHLQ 73
                        79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.4E-142274IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-232273IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-202374IPR006447Myb domain, plants
PfamPF002495.9E-72773IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MTEGSSKKQR CDRVVASHDL NRKPRFRWTV ELHEMFVKAV NELGGPYDAT PKNIVKLMDD  60
EDITPEHIKS HLQVSKPLYA CVFSFLFLSI RFLRLIDYME HECI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-162373252Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-162373252Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-162373151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-162373151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-162373151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-162373151Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-162373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-162373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-162373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-162373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-162373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-162373252Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout all stages of plant growth. {ECO:0000269|PubMed:26082401}.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and fruits (PubMed:18263782). Expressed in the root cap and in the exodermis, sclerenchyma and vascular tissues of the root, in the cortex cells and the stele of lateral roots, in the mesophyll cells of the leaf, in pollen, vascular cylinder of the anther and the veins of the lemma, palea and pistils, and in all node I tissues (PubMed:26082401). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis. PHR2 binding to DNA is repressed redundantly by SPX1, SPX2 and SPX4 in a PI-dependent manner. {ECO:0000250|UniProtKB:Q6Z156}.
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:19704822, ECO:0000269|PubMed:20149131, ECO:0000269|PubMed:24692424, ECO:0000269|PubMed:25271318, ECO:0000269|PubMed:25657119, ECO:0000269|PubMed:26082401}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g049640.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025887824.11e-49myb family transcription factor PHL12-like
RefseqXP_027774019.11e-49myb family transcription factor PHL8-like
SwissprotB8B5N84e-15PHR2_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 2
SwissprotQ6Z1564e-15PHR2_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 2
TrEMBLA0A3Q7HE161e-72A0A3Q7HE16_SOLLC; Uncharacterized protein
STRINGSolyc07g049640.2.12e-73(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120621623
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.44e-17G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  3. Wang C, et al.
    Involvement of OsSPX1 in phosphate homeostasis in rice.
    Plant J., 2009. 57(5): p. 895-904
    [PMID:19000161]
  4. Zhang Q,Wang C,Tian J,Li K,Shou H
    Identification of rice purple acid phosphatases related to phosphate starvation signalling.
    Plant Biol (Stuttg), 2011. 13(1): p. 7-15
    [PMID:21143719]
  5. Wu Z,Ren H,McGrath SP,Wu P,Zhao FJ
    Investigating the contribution of the phosphate transport pathway to arsenic accumulation in rice.
    Plant Physiol., 2011. 157(1): p. 498-508
    [PMID:21715673]
  6. Chen J, et al.
    OsPHF1 regulates the plasma membrane localization of low- and high-affinity inorganic phosphate transporters and determines inorganic phosphate uptake and translocation in rice.
    Plant Physiol., 2011. 157(1): p. 269-78
    [PMID:21753117]
  7. Wang C, et al.
    Functional characterization of the rice SPX-MFS family reveals a key role of OsSPX-MFS1 in controlling phosphate homeostasis in leaves.
    New Phytol., 2012. 196(1): p. 139-48
    [PMID:22803610]
  8. Tian J, et al.
    Overexpression of OsPAP10a, a root-associated acid phosphatase, increased extracellular organic phosphorus utilization in rice.
    J Integr Plant Biol, 2012. 54(9): p. 631-9
    [PMID:22805094]
  9. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  10. Wu P,Shou H,Xu G,Lian X
    Improvement of phosphorus efficiency in rice on the basis of understanding phosphate signaling and homeostasis.
    Curr. Opin. Plant Biol., 2013. 16(2): p. 205-12
    [PMID:23566853]
  11. Wang S, et al.
    Auxin response factor (OsARF12), a novel regulator for phosphate homeostasis in rice (Oryza sativa).
    New Phytol., 2014. 201(1): p. 91-103
    [PMID:24111723]
  12. Shi J, et al.
    The paralogous SPX3 and SPX5 genes redundantly modulate Pi homeostasis in rice.
    J. Exp. Bot., 2014. 65(3): p. 859-70
    [PMID:24368504]
  13. Li S,Wang C,Zhou L,Shou H
    Oxygen deficit alleviates phosphate overaccumulation toxicity in OsPHR2 overexpression plants.
    J. Plant Res., 2014. 127(3): p. 433-40
    [PMID:24687599]
  14. Zhou Z, et al.
    SPX proteins regulate Pi homeostasis and signaling in different subcellular level.
    Plant Signal Behav, 2015. 10(9): p. e1061163
    [PMID:26224365]
  15. Zhang K, et al.
    Down-regulation of OsSPX1 caused semi-male sterility, resulting in reduction of grain yield in rice.
    Plant Biotechnol. J., 2016. 14(8): p. 1661-72
    [PMID:26806409]
  16. Cao Y, et al.
    Identification and expression analysis of OsLPR family revealed the potential roles of OsLPR3 and 5 in maintaining phosphate homeostasis in rice.
    BMC Plant Biol., 2016. 16(1): p. 210
    [PMID:27716044]