PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g045180.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 419aa    MW: 46133.5 Da    PI: 5.3208
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g045180.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.78.6e-07444539
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                        +C+ ++e++ + +C++++ +lC +C  ++H+       H++
  Solyc07g045180.2.1  4 ICEYCGEQRSIVYCRSDSACLCLSCDRNIHSAnalsqrHSR 44
                        7*****************************65677777765 PP

2zf-B_box22.32.7e-074687439
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         +C++++++++++ C + ++ lC++C    H +      H++
  Solyc07g045180.2.1 46 LVCERCNSQPAIFRCVEERVSLCQNCDWLAHASsgtcstHKR 87
                        68************************9999976777777876 PP

3CCT58.91.8e-20361403143
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                         R  a++RYkeK+ktR+F+K++rY sRKa+Ae R RvKGrFvk 
  Solyc07g045180.2.1 361 RSDAVSRYKEKKKTRQFDKRVRYVSRKARAEVRRRVKGRFVKD 403
                         889**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.542147IPR000315B-box-type zinc finger
CDDcd000217.76E-7447No hitNo description
SMARTSM003365.0E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.8874390IPR000315B-box-type zinc finger
PfamPF006433.4E-54688IPR000315B-box-type zinc finger
CDDcd000213.34E-44790No hitNo description
SMARTSM003360.134890IPR000315B-box-type zinc finger
PROSITE profilePS5101714.763361403IPR010402CCT domain
PfamPF062033.6E-15361403IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MGYICEYCGE QRSIVYCRSD SACLCLSCDR NIHSANALSQ RHSRTLVCER CNSQPAIFRC  60
VEERVSLCQN CDWLAHASSG TCSTHKRQAL SCYTGCPSAV ELSTIWSFIL GDPSVCDSTC  120
EQGMGSMSIT DCQPGDSQHP QVKEKSQDIS SDEAKDLHNL VKSAPFMGSS MPSLDNELPN  180
VELLVASTNL TWSKVKNSGT KGYNDPFYDD FNMDEVDLSI ENYKELFGVS IDNCDQLFKN  240
EDIDDFFGMK DMSVAESSFQ GVNAVEVIVD NGKAPGSAVG KVNAVKSACS NAASAESMMS  300
CKTEPPTLCF AMQQSSFSFS NLTGESNAGD CQDCGASSML RMGEPSWHPP CPESSMPSTS  360
RSDAVSRYKE KKKTRQFDKR VRYVSRKARA EVRRRVKGRF VKDGDAYDYD PLHQTRSY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.68050.0fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g045180.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004243599.10.0zinc finger protein CONSTANS-LIKE 10
SwissprotQ9LUA91e-120COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLM1BGT70.0M1BGT7_SOLTU; B-box zinc finger protein 7
STRINGSolyc07g045180.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12702468
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-111B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]