PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g042260.2.1
Common NameLOC100191131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 1138aa    MW: 127856 Da    PI: 6.6348
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g042260.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.55.1e-23126227199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++ ++W++++iyr++++r++lt+GW+ F ++++L++gD+v+F +
  Solyc07g042260.2.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldyaMQPPAQ--ELMARDLHDQTWTFRHIYRGQPKRHLLTTGWSVFISSKRLCAGDSVLFIR 214
                         99******************************5444444..8************************************************4 PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                           +++ +l++++ r+
  Solyc07g042260.2.1 215 --DEKSQLLLGIKRT 227
                         ..4666678888775 PP

2Auxin_resp123.31.8e-40252334183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+++s+F+++YnPras+seFv++++k++ka++ +vs+GmRf+m+fete+s  rr++Gt++gvsdldp+rW+ S+Wr+L+
  Solyc07g042260.2.1 252 AAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYAQVSLGMRFRMMFETEESGVRRYMGTITGVSDLDPIRWKSSQWRNLQ 334
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.76E-43116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-40118241IPR015300DNA-binding pseudobarrel domain
CDDcd100173.98E-18125226No hitNo description
PROSITE profilePS5086312.026126228IPR003340B3 DNA binding domain
PfamPF023626.0E-20126227IPR003340B3 DNA binding domain
SMARTSM010193.6E-22126228IPR003340B3 DNA binding domain
PfamPF065071.4E-35252334IPR010525Auxin response factor
PfamPF023091.0E-810011097IPR033389AUX/IAA domain
PROSITE profilePS5174527.52910111095IPR000270PB1 domain
SuperFamilySSF542772.21E-910121089No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1138 aa     Download sequence    Send to blast
MKAPSNGYLP NSGEGERKLM NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TDGIPSYPNL PSKLICMLHN VTLHADTETD EVYAQMTLQP VNKYDQEALL LSEMGLKQNR  120
QPAEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDYAMQ PPAQELMARD LHDQTWTFRH  180
IYRGQPKRHL LTTGWSVFIS SKRLCAGDSV LFIRDEKSQL LLGIKRTNRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVIPLA KYNKAMYAQV SLGMRFRMMF  300
ETEESGVRRY MGTITGVSDL DPIRWKSSQW RNLQVGWDES TAGERPSRVS IWDIEPVVTP  360
FYICPPPFFR PKFPKQPSFP GDESDIENVL KRGMPWINDE LGLKDAQNSI FPGLSLVQWM  420
SMQQNNHVPV AQSGLPSVLH SNIGSDDHSK LLNFQSPALA TPGLQFNKPN QLNQPFGQIQ  480
QPPLAWTQEQ QQSLQSPVSA QQQQQQQHTL QQQQQQQQHT LQQQQQQRHT LQQQQQQQTL  540
QQQQQQQQQQ HTLQQQQQQQ HTLQHQQQHT LQQPQQHMLQ QQPQFHQQAQ QQLQQQQRPS  600
QQQQLTGNSS PVNRCVSPNQ IPNQTFPQAA VYGQLQQQQV LSASTQSQQN VPVSRNSFPS  660
TSLAQDFQFQ QQMEQQSNLL QKSQQQQTIP QQAPLQLLQQ SLMQRSQVQP SSQQSLTEQQ  720
LQLQLLNKLQ QQQQQQQAQL LSPVSSTLEP RMPQQQQNRQ PQELQFAHQQ LSSNIVTTVT  780
HLQSTHHAFN QLQNHHKSPI TIKALSGGTE GDAPSCSTSP STNNFQVSPP NFLTRNQGQA  840
ILVDESVVDP SQEQNKSECR IKHELVFSKG SELSKYKGNN TENLEAASST TSYGLDSSGF  900
NFSLPALCVD GDVQSHSRNI LPSAANNIDG LNPDALLSRD YDSGKDIQNL FSPFGNAPRD  960
IETELSDAGI NSQQFGVPNM SYKPRCANDL AVNDNGILNN NAWTNQTQRM RTYTKVQKRG  1020
SVGRTIDVTR YIGYDELRHD LARMFGIEGQ LEDPQRTEWK LVYVDHENDI LLVGDDPWEE  1080
FVSCVQSIKI LSCAEVQQMS LNGDLGNVPV PNQASSGTDS GNAWKGHYDD NSAASFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1711535545388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.224860.0leaf
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Involved in ethylene responses. Regulates lateral root formation through direct regulation of LBD16 and/or LBD29. Functionally redundant with ARF7. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:16461383, ECO:0000269|PubMed:17259263}.
Function -- GeneRIF ? help Back to Top
  1. SlARF7 acts as a negative regulator of fruit set until pollination and fertilization have taken place, and moderates the auxin response during fruit growth. [SlARF7]
    [PMID: 18778404]
  2. ARF7 mediates cross-talk between auxin and gibberellin signalling during fruit development. [ARF7]
    [PMID: 20937732]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g042260.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and ethylene. {ECO:0000269|PubMed:16461383}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1215450.0Solanum lycopersicum auxin response factor mRNA, partial cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004243692.10.0auxin response factor 7 isoform X1
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLB5SP990.0B5SP99_SOLLC; Auxin response factor (Fragment)
STRINGSolyc07g042260.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13022465
Representative plantOGRP9033914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. de Jong M,Wolters-Arts M,Feron R,Mariani C,Vriezen WH
    The Solanum lycopersicum auxin response factor 7 (SlARF7) regulates auxin signaling during tomato fruit set and development.
    Plant J., 2009. 57(1): p. 160-70
    [PMID:18778404]
  4. de Jong M,Wolters-Arts M,Garc
    The Solanum lycopersicum AUXIN RESPONSE FACTOR 7 (SlARF7) mediates cross-talk between auxin and gibberellin signalling during tomato fruit set and development.
    J. Exp. Bot., 2011. 62(2): p. 617-26
    [PMID:20937732]
  5. Perilli S, et al.
    RETINOBLASTOMA-RELATED protein stimulates cell differentiation in the Arabidopsis root meristem by interacting with cytokinin signaling.
    Plant Cell, 2013. 25(11): p. 4469-78
    [PMID:24285791]
  6. Sun Y, et al.
    Manipulation of Auxin Response Factor 19 affects seed size in the woody perennial Jatropha curcas.
    Sci Rep, 2017. 7: p. 40844
    [PMID:28102350]
  7. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  8. Olmo R, et al.
    Molecular Transducers from Roots Are Triggered in Arabidopsis Leaves by Root-Knot Nematodes for Successful Feeding Site Formation: A Conserved Post-Embryogenic De novo Organogenesis Program?
    Front Plant Sci, 2017. 8: p. 875
    [PMID:28603536]
  9. Lee K,Seo PJ
    High-temperature promotion of callus formation requires the BIN2-ARF-LBD axis in Arabidopsis.
    Planta, 2017. 246(4): p. 797-802
    [PMID:28766014]
  10. Ayala-Rodríguez JÁ,Barrera-Ortiz S,Ruiz-Herrera LF,López-Bucio J
    Folic acid orchestrates root development linking cell elongation with auxin response and acts independently of the TARGET OF RAPAMYCIN signaling in Arabidopsis thaliana.
    Plant Sci., 2017. 264: p. 168-178
    [PMID:28969797]
  11. Nakamura M, et al.
    Auxin and ROP GTPase Signaling of Polar Nuclear Migration in Root Epidermal Hair Cells.
    Plant Physiol., 2018. 176(1): p. 378-391
    [PMID:29084900]
  12. Hong L, et al.
    Alternative polyadenylation is involved in auxin-based plant growth and development.
    Plant J., 2018. 93(2): p. 246-258
    [PMID:29155478]
  13. Lee K,Park OS,Seo PJ
    Arabidopsis ATXR2 deposits H3K36me3 at the promoters of LBD genes to facilitate cellular dedifferentiation.
    Sci Signal, 2018.
    [PMID:29184030]
  14. Kimura T, et al.
    Asymmetric Auxin Distribution is Not Required to Establish Root Phototropism in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 823-835
    [PMID:29401292]
  15. Schoenaers S, et al.
    The Auxin-Regulated CrRLK1L Kinase ERULUS Controls Cell Wall Composition during Root Hair Tip Growth.
    Curr. Biol., 2018. 28(5): p. 722-732.e6
    [PMID:29478854]
  16. Huang KL, et al.
    The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots.
    Plant Physiol., 2018. 178(1): p. 413-427
    [PMID:30026290]