PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g041640.2.1
Common NameLOC101255511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 345aa    MW: 39590.1 Da    PI: 9.0709
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g041640.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.94.7e-2578121144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  Solyc07g041640.2.1  78 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 121
                         79***************************************986 PP

2QLQ57.93.1e-201145236
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        +FTa+Q+q+L++Q+l+yKy+++++PvP++Ll  i+
  Solyc07g041640.2.1 11 PFTANQWQELEHQALIYKYMVSGMPVPADLLYTIR 45
                        8*****************************97775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-111046IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.3421146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.1E-151144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.94178122IPR014977WRC domain
PfamPF088793.1E-2179121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MMSSTGRSRF PFTANQWQEL EHQALIYKYM VSGMPVPADL LYTIRRSLDS SLSSKLLIHQ  60
PHHIGWNCFQ MGFGKKIDPE PGRCRRTDGK KWRCSKEAYP DSKYCERHMH RGRNRSRKPV  120
EIMTNNNTSS STTTRPIIPP TAIPISSINK NTNTCSPTSF SYLTSSSSST HEPHHNYPFH  180
YRPPQDHTPK FLFESPTTYS RSGMKEEVGE HVFFSSEASG TMRSTCGSNS IESDTWQLSP  240
LTMSSSPMKQ RTTYSPSQST AHSYLQLQSL NESSRQNYYY HNDVEKEDHQ PKKVMHHFFD  300
EWPPKDNKHS WLDSDDKFSG LSRTQLSISI PNPSQDLFIT TNEK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g041640.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004243717.10.0growth-regulating factor 1-like
TrEMBLA0A3Q7H8B20.0A0A3Q7H8B2_SOLLC; Uncharacterized protein
STRINGSolyc07g041640.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7432384
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-53growth-regulating factor 5
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]