PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g026680.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 197aa    MW: 21757.7 Da    PI: 10.6412
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g026680.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.31e-14122165447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         WT+eE+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
  Solyc07g026680.2.1 122 WTEEEHRRFLMGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKY 165
                         *******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.333114170IPR017930Myb domain
SuperFamilySSF466895.01E-17116170IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-18118168IPR006447Myb domain, plants
SMARTSM007172.1E-10118168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-11120165IPR009057Homeodomain-like
CDDcd001673.30E-9122166No hitNo description
PfamPF002496.8E-12122165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRKCSRCRN IGHNSRTCST FKLGASANFV GGLRLFGVQL IDISSSSSTS SSSSSSSSSS  60
YDIHLKKSLS LDCMSSPQVS ISPSSSSSLV TLNEKSTTCT NGDYLSDCLL GQPKERRKGV  120
GWTEEEHRRF LMGLEKLGKG DWRGISRKFV TTRTPTQVAS HAQKYFLRHS THLNKKKRRS  180
SLFDMVCRIY ILSTFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174178KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g026680.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242968.11e-132transcription factor MYBS3-like
TrEMBLM1AKK41e-100M1AKK4_SOLTU; Uncharacterized protein
STRINGSolyc07g026680.2.11e-140(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-48MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]