PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g019550.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 368aa    MW: 41972.8 Da    PI: 7.0031
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g019550.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.11.6e-22190243155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++Wt  LH++Fv++v++L G ++A P++il+ m+ + Lt+ hv+SHLQkYR+
  Solyc07g019550.1.1 190 KTRIVWTDPLHNKFVDVVSKL-GMKEAHPRKILDRMDTPELTRIHVASHLQKYRM 243
                         68*******************.9*******************************7 PP

2Response_reg52.52.8e-18151212108
                         EEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHH CS
        Response_reg   2 livdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedaleal 90 
                         l+vd +++ + + +++l+k+++ ev +++++++al  l+ +   ++l+++ + mp+++G++l +ei+++  ++p+ + +  ++e+++++ l
  Solyc07g019550.1.1  15 LLVDVDDSCLLITATFLKKSKF-EVVTVKSAKDALGVLRSSGlsFELVVTEVHMPEINGFQLQQEIAKKF-NIPVAFYSVDEKESTIIKGL 103
                         789999999*************.***************999888**********************9999.9******************* PP

                         HTTESEEEESS--HHHHH CS
        Response_reg  91 kaGakdflsKpfdpeelv 108
                         + G+  f  Kp+++++++
  Solyc07g019550.1.1 104 ESGVILFMGKPISQNDII 121
                         *************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23006.9E-2312163No hitNo description
SMARTSM004481.2E-1212124IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521725.83E-2013143IPR011006CheY-like superfamily
PROSITE profilePS5011026.51513128IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-1415121IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.01E-1615121No hitNo description
SuperFamilySSF466896.81E-16188247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-23188247IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-20190243IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MEEQNNQFFE IIRCLLVDVD DSCLLITATF LKKSKFEVVT VKSAKDALGV LRSSGLSFEL  60
VVTEVHMPEI NGFQLQQEIA KKFNIPVAFY SVDEKESTII KGLESGVILF MGKPISQNDI  120
IFLWKYAAMR KKIYKGKQVI NQQNQDDANE RIPHEVIHIE SSSPDSERDK SARKSEENKS  180
EHSSSPPSKK TRIVWTDPLH NKFVDVVSKL GMKEAHPRKI LDRMDTPELT RIHVASHLQK  240
YRMDLKKDSR VQQLMPENSN VVDHVIETDH QDFHSCQREK ELARILCRHI NKMSHNIGLG  300
EASIELSTLQ QSYEITGNGG TGTTTDDFVM LDNVYSTELT SIISGSQLNV QSSNMVRFFK  360
FFRLFSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-14189249464ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g019550.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004243095.10.0two-component response regulator ARR14-like
TrEMBLK4CCR70.0K4CCR7_SOLLC; Uncharacterized protein
STRINGSolyc07g019550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32902038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01760.13e-33response regulator 14
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]