PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g009580.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 435aa    MW: 49240 Da    PI: 6.9137
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g009580.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like61.91.3e-19190239555
             G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          W   LH++Fve+v+ L G ++A Pk++ elm+++ Lt ++++SHLQkYRl
  Solyc07g009580.1.1 190 LWRDPLHNKFVEVVDIL-GVKNARPKKVHELMNMPELTKKQIASHLQKYRL 239
                         5999*************.9*******************************8 PP

2Response_reg40.12e-14111141105
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         +l+vdD + ++  +++ l+ +++ ev  + + e al  l+ +   +Dl+l+Di m +md +++l+ei++e  ++pi +++  ++++++++ 
  Solyc07g009580.1.1  11 ILVVDDINCNLTTIAS-LKYSQF-EVMIVNSIEVALGGLRSSGlsFDLLLTDIHMLKMDVFQFLQEIAKEF-DIPICFMSNDKKDSTLIKG 98 
                         899***9999999986.788***.***************999888**********************9988.9****************** PP

                         HHTTESEEEESS--HH CS
        Response_reg  90 lkaGakdflsKpfdpe 105
                         l+  a  f  Kp+ ++
  Solyc07g009580.1.1  99 LDNRAVFFTLKPITQD 114
                         ************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.85E-168131IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.5E-188131No hitNo description
SMARTSM004488.2E-89120IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011020.02710124IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-1011114IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.07E-1212114No hitNo description
Gene3DG3DSA:1.10.10.601.5E-19184243IPR009057Homeodomain-like
SuperFamilySSF466891.97E-13185243IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-17190239IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MEVENSKKGR ILVVDDINCN LTTIASLKYS QFEVMIVNSI EVALGGLRSS GLSFDLLLTD  60
IHMLKMDVFQ FLQEIAKEFD IPICFMSNDK KDSTLIKGLD NRAVFFTLKP ITQDGINYLW  120
NYATSLGKKK HKGKQVVQVF EENTNEKILN EVIDIESPSF VSKKDKSIRK YDDVENKDYS  180
SQRAKKSITL WRDPLHNKFV EVVDILGVKN ARPKKVHELM NMPELTKKQI ASHLQKYRLT  240
LDKKPNPKLV LDSSKTTSGN ANQLSIKTDN ISALAPQVMT KNLNNAGPDT EPDLRNFMSD  300
YEKDRNFSNI LSRHLNQKPC KLQGNHEGIN ADGISLQLGN VLPNSNLEQG KYANITAKER  360
PLHSRTVSPN LALQQEIYGD VTAEDALFDH LNVRSNSENG SRDYESFTAE DWSFLNSLLL  420
DHELEVVSYI HFVC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-13185243462ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g009580.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2536591e-170Solanum lycopersicum strain Heinz 1706 chromosome 7 clone slm-33k4 map 7, complete sequence
GenBankAC2536661e-170Solanum lycopersicum strain Heinz 1706 chromosome 7 clone sle-48d7 map 7, complete sequence
GenBankAC2539891e-170Solanum lycopersicum strain Heinz 1706 chromosome 7 clone sle-46l4 map 7, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027774110.10.0two-component response regulator ARR14-like
TrEMBLA0A3Q7I1R00.0A0A3Q7I1R0_SOLLC; Uncharacterized protein
STRINGSolyc07g009580.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1581437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.15e-35response regulator 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]