PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g009110.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 579aa    MW: 65564.1 Da    PI: 4.5898
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g009110.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.31.1e-20192245155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++Wt +LH++F eav++L    +  P+ ile+m+v+gLtl++++SHLQkYR 
  Solyc07g009110.1.1 192 KTRIVWTDDLHSKFQEAVNKL-NDGRCFPSDILEAMNVPGLTLYQIASHLQKYRN 245
                         68*******************.899*****************************6 PP

2Response_reg34.51e-12191191102
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl++dD++ + + +  +le+++y +v+++d++++ + +l + +  +Dl+++ ++ p++  ++ll +  +++  + i ++ ++ +   a++a
  Solyc07g009110.1.1  19 VLLIDDDKEFVNEMIYLLESHEY-KVRTVDTASQGMSMLSKGKenIDLMIINMNSPDLLSFQLLNQAITSD-IVSICIC-DEYDTRSAKKA 106
                         89*********************.***************777667************99999998875555.3555555.5566699**** PP

                         HHTTESEEEESS- CS
        Response_reg  90 lkaGakdflsKpf 102
                         ++ Ga  +l Kp 
  Solyc07g009110.1.1 107 FENGAYFYLQKPL 119
                         ***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.8E-1516153No hitNo description
SuperFamilySSF521722.99E-1516137IPR011006CheY-like superfamily
SMARTSM004482.7E-417128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011022.68618132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-719119IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.79E-1020118No hitNo description
Gene3DG3DSA:1.10.10.602.0E-21190246IPR009057Homeodomain-like
SuperFamilySSF466893.23E-16190245IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-18192246IPR006447Myb domain, plants
PfamPF002491.5E-5196244IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MIENSMINFY HDLINEVSVL LIDDDKEFVN EMIYLLESHE YKVRTVDTAS QGMSMLSKGK  60
ENIDLMIINM NSPDLLSFQL LNQAITSDIV SICICDEYDT RSAKKAFENG AYFYLQKPLL  120
HEYVKSMWQL VLQKNIQKVK VIDLDKQEND IHETTNGVVC NEKYKLKRKR GKKLIEEKKS  180
ESSATKVVIQ QKTRIVWTDD LHSKFQEAVN KLNDGRCFPS DILEAMNVPG LTLYQIASHL  240
QKYRNNTWKA PRKRKSTCHS SSQLGTSSGS SNLRIFETIS HLKRNVTNLQ QQETQRAPKT  300
PFLPNNNIFS RGESSSLQKV YHPQLQVDPQ YFNPFDTPLL SSSENNNVVG LQQHEKPLSE  360
SWGLQGSNIG TAEYTPGLKF NEINHAQNNY ALDVEKYSTM FDTNITNPTI NELVAANIDF  420
QQYIGELQGS NIESADYTPG LKFNNGIPHA QNDYALDVAS YATLPNTNIA NPTIDGLSVA  480
NIGFEQHIDE QNMVQPLNNV VTTSHMSGTQ ESEPSEMMNC DEFFDFDNMD FFFQNDEPPS  540
FDLSNELDSA FDQAYSDDMA TSSAQFPDIT SFLDDSST*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165172LKRKRGKK
2248254KAPRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g009110.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010323484.20.0putative two-component response regulator ARR20
TrEMBLA0A3Q7H4Q00.0A0A3Q7H4Q0_SOLLC; Uncharacterized protein
STRINGSolyc07g009110.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.14e-26response regulator 12
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]