PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g008180.2.1
Common NameLOC101247536
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family YABBY
Protein Properties Length: 181aa    MW: 20341.2 Da    PI: 8.4989
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g008180.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY218.91.5e-6761634170
               YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast 94 
                         + +s+q+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q  ++ s  ++++ +  + e +++  + ++ ++++ s + 
  Solyc07g008180.2.1   6 DVASDQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSSSSASWQNHQVPNYTAPEYRMDFGSSTKCNMNRMSMR- 95 
                         5689*******************************************9999998888875555555555555554443333333333222. PP

               YABBY  95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                                 +  +++v +   v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl
  Solyc07g008180.2.1  96 --------TPITNNVHEERIVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 163
                         ........23333333344589****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.9E-718163IPR006780YABBY protein
SuperFamilySSF470955.24E-8108156IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.3E-4111157IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MASCIDVASD QLCYIPCNFC NIVLAVSVPC SSLFDIVTVR CGHCTNLWSV NMAAAFQSSS  60
SASWQNHQVP NYTAPEYRMD FGSSTKCNMN RMSMRTPITN NVHEERIVNR PPEKRQRVPS  120
AYNQFIKEEI QRIKANNPDI SHREAFSTAA KNWAHFPHIH FGLMLESNNQ AKLACGSRKL  180
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.103520.0flower| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g008180.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2326312e-69Solanum lycopersicum chromosome 7 clone C07SLe0071O22, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353827.11e-134axial regulator YABBY5a isoform 2
SwissprotQ8GW464e-87YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A068FJR21e-127A0A068FJR2_9SOLN; YAB5 protein
STRINGSolyc07g008180.2.11e-133(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Representative plantOGRP22101236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.21e-84YABBY family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]