PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g006630.2.1
Common NameLOC100191137
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 387aa    MW: 42603.8 Da    PI: 6.8182
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g006630.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.16.7e-072561440
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkgHtvv 40
                        + C+ ++   +  fC+++++++C +C +  H +H++v
  Solyc07g006630.2.1 25 KSCEYCHLAAALVFCRTDNTFVCLSCDTRLHARHERV 61
                        68*****999************************976 PP

2zf-B_box25.13.6e-0861106342
            zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                          ++C+ +e+  ++  C+ +   lC  C   +H+       H++vp+
  Solyc07g006630.2.1  61 VWVCEVCEQAAASVTCRADAAALCVACDRDIHSAnplarrHERVPV 106
                         689*******9*********************66899999999986 PP

3CCT69.86.8e-24307350144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Solyc07g006630.2.1 307 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 350
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.4562263IPR000315B-box-type zinc finger
SMARTSM003366.5E-72263IPR000315B-box-type zinc finger
PfamPF006432.0E-52561IPR000315B-box-type zinc finger
CDDcd000212.87E-82763No hitNo description
PROSITE profilePS5011911.02159106IPR000315B-box-type zinc finger
PfamPF006432.0E-660106IPR000315B-box-type zinc finger
CDDcd000213.62E-962106No hitNo description
SMARTSM003361.3E-964106IPR000315B-box-type zinc finger
PfamPF062038.7E-18307349IPR010402CCT domain
PROSITE profilePS5101716.638307349IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGIFREAPNC FPGGWNIGAA ARMAKSCEYC HLAAALVFCR TDNTFVCLSC DTRLHARHER  60
VWVCEVCEQA AASVTCRADA AALCVACDRD IHSANPLARR HERVPVVPFY DPVESVVKST  120
AATLLVSING TTTTATTTAT ITPELGKVDT CIGHHENNND PWIPPNTITS KLPLNTEMKG  180
MDFIFTDSEN FLDFDYPACV DTQSQPHYNS SNDSVVPVQA NTPIKSLPFH HQEKHFEIDF  240
TQSHIKSYNT PSLSVSSSSL DVGIVPDGSS ISEISYPYIR TMNNSNSSID LSNSANHQGE  300
KLLGLDREAR VLRYREKKKN RKFEKTIRYA SRKAYAETRP RIKGRFAKRT DGSAGAGEFD  360
DVDGIFSGTD FIAAESRYGV VPSFLT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.105170.0callus| floral bud| flower| fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g006630.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6366980.0Solanum lycopersicum CONSTANS-like protein mRNA, complete cds
GenBankGQ2612280.0Solanum lycopersicum cultivar Rio Grande PtoR Hop-interacting protein THI010 mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234448.10.0CONSTANS-like protein
TrEMBLA0A3Q7I0610.0A0A3Q7I061_SOLLC; Uncharacterized protein
STRINGSolyc07g006630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.16e-97CONSTANS-like 5
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]