PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g005140.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 666aa    MW: 73325.8 Da    PI: 7.2618
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g005140.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.3e-27211263255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +r++W+ eLH++Fv av qL G+ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Solyc07g005140.2.1 211 ARVVWSIELHRKFVAAVGQL-GIEKAVPKRILDLMNVDGLTRENVASHLQKYRL 263
                         79******************.********************************8 PP

2Response_reg814e-27281361109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ ++ll  +l+k +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+++ +++ + 
  Solyc07g005140.2.1  28 VLAVDDDPICLKLLDGLLRKCQY-QVTTTSQARMALKMLRENRdrFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANSDTKLVRKG 116
                         799********************.***************999889*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l+Kp+ +eel++
  Solyc07g005140.2.1 117 IDHGACDYLVKPVRIEELRN 136
                         ******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-1584652IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.6E-4325160No hitNo description
SuperFamilySSF521724.98E-3625153IPR011006CheY-like superfamily
SMARTSM004488.0E-3326138IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.89727142IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-2428137IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.20E-2929142No hitNo description
PROSITE profilePS5129412.655207266IPR017930Myb domain
SuperFamilySSF466891.79E-18207267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28207268IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23211263IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MTVEEIRGNM SGGERGNNYD NFPIGMRVLA VDDDPICLKL LDGLLRKCQY QVTTTSQARM  60
ALKMLRENRD RFDLVISDVH MPDMDGFKLL ELVGLEMDLP VIMLSANSDT KLVRKGIDHG  120
ACDYLVKPVR IEELRNIWQH VIRKKKVEPK SQSKSNDQDK SYQVSGESGR GQSPTGNVYP  180
NGKCNKKRKD EEDENDENGN DNEDPTTQKR ARVVWSIELH RKFVAAVGQL GIEKAVPKRI  240
LDLMNVDGLT RENVASHLQK YRLYLKRINS VQTQQANMVA ALGGRDYVRM GSLDGLGDFR  300
TLGGSGRYTH AALSSYSSGG MLGRLNSAAG LSVRNLAASQ LLQPSHGQNL SNSVNAFTKL  360
NPSIPPASQN ASLFQGIPAS LELDQLQQSK SSAHIPLDES RLLTTDVLGC SNNSLPNNPM  420
LLPGNPQQPL TGGGFGNQHS QNITPFSSDS FNTGVNGSSN FLEHGRCNDW QNSVQLSKFQ  480
SNSFPLTESF INSHLPQISA REAAAHLQNS PLDFTSTTSV SPPFEDSRGE IQFRQSMASA  540
VQSMNQTPSQ AWADNKQQYS HNSNNTFGNN LSSQVPNDGS MASLSHSMNQ NNENFGRRMD  600
MSLIGRSSGG SSTLVQHTEH EKLTPDSRTR SNEEYLLEPT KQQVGFSPQG YDSLDDLMTA  660
MKRRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-24206269164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g005140.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242565.10.0two-component response regulator ORR24 isoform X1
SwissprotB8AEH11e-136ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLM0ZUD20.0M0ZUD2_SOLTU; Two-component response regulator
STRINGSolyc07g005140.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22582458
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-114response regulator 12
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]