PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g076350.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 323aa    MW: 36183.4 Da    PI: 5.5545
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g076350.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.5e-29150203155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rF+e+v++L G++ A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Solyc06g076350.2.1 150 RPRLVWTPQLHKRFIEVVAHL-GIKGAVPKTIMQLMNVEGLTRENVASHLQKYRL 203
                         59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.383145206IPR017930Myb domain
SuperFamilySSF466899.14E-19147207IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-29149208IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-23151203IPR006447Myb domain, plants
PfamPF002492.5E-8153202IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGEEVSLTDY ESSGGNDDRL LWEIGLPDVD DLTPLNMQLI PSELAAAFRI SPELSKTMTD  60
VNRASQNTFS SLQRWHSQDM ASMNNSNFKT FSYERSREET VTERDETDLI REGSDSRKLR  120
RVESGGTEEA DSSLCNENFA DDSSAKTLKR PRLVWTPQLH KRFIEVVAHL GIKGAVPKTI  180
MQLMNVEGLT RENVASHLQK YRLYTKRMQP NEGPSSSDHL LTSTPATEIM RESSESGHLR  240
NTNGHMAMPT LMPYQQQMVA MPMMGMPNGG HVGMPVGYGG GPPLGFHHHY NVVQQRDWSG  300
NNFGYYHPVA SNDKYVDLDD VI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A7e-32150206157Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.68800.0fruit| leaf| root| seed
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Is necessary for activation of CCA1 and LHY expression. Is coregulated with TOC1 and seems to be repressed by CCA1 and LHY by direct binding of these proteins to the evening element in the LUX promoter. Directly regulates the expression of PRR9, a major component of the morning transcriptional feedback circuit, by binding specific sites on PRR9 promoter. Binds to its own promoter, inducing a negative auto-regulatory feedback loop within the core clock. Binds to ELF3 and associates with ELF4 in a diurnal complex which is required for the expression of the growth-promoting transcription factors PIF4 and PIF5 and subsequent hypocotyl growth in the early evening. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:21236673, ECO:0000269|PubMed:21753751, ECO:0000269|PubMed:22311777}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g076350.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:17132630, ECO:0000269|PubMed:21753751}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2190700.0Solanum lycopersicum LePCL1 mRNA, partial cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001308215.10.0transcription factor PCL1
RefseqXP_004241214.10.0transcription factor PCL1 isoform X1
RefseqXP_010322338.10.0transcription factor PCL1 isoform X1
SwissprotQ9SNB46e-70PCL1_ARATH; Transcription factor LUX
TrEMBLA0A3Q7H4910.0A0A3Q7H491_SOLLC; Uncharacterized protein
STRINGSolyc06g076350.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35802343
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.25e-70G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Higham CF,Husmeier D
    A Bayesian approach for parameter estimation in the extended clock gene circuit of Arabidopsis thaliana.
    BMC Bioinformatics, 2013. 14 Suppl 10: p. S3
    [PMID:24267177]