PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g075670.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 59aa    MW: 6943.98 Da    PI: 5.0684
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g075670.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-08839132
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                        +g+WT++Ed +lv +vk++G ++W+  a+  g
  Solyc06g075670.1.1  8 KGPWTEQEDVQLVFYVKMFGDRRWDFLAKVSG 39
                        79***********************9999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.888347IPR017877Myb-like domain
SuperFamilySSF466891.08E-7437IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-8739IPR009057Homeodomain-like
PfamPF002491.4E-6838IPR001005SANT/Myb domain
CDDcd001672.62E-41041No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
MVEEEMRKGP WTEQEDVQLV FYVKMFGDRR WDFLAKVSGL KVGIGGREYR LSFERETL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g075670.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0130441e-95Lycopersicon esculentum clone 114294R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015077480.11e-21transcription factor MYB48-like
SwissprotQ53NK62e-16MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLA0A3Q7HWX12e-22A0A3Q7HWX1_SOLLC; Uncharacterized protein
STRINGSolyc06g075670.1.12e-34(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1619035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-17myb domain protein 59
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]