PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g075660.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 164aa    MW: 19020.9 Da    PI: 4.7602
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g075660.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-16243548
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        T++E++l ++++ ++G++ W++Ia +++ gRt++++k++w++++
  Solyc06g075660.2.1  2 TPQEELLVLQLHSKYGNR-WSKIAGKLP-GRTDNEIKNYWRTHM 43
                        9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001671.78E-11143No hitNo description
SMARTSM007171.2E-11145IPR001005SANT/Myb domain
PROSITE profilePS5129424.888147IPR017930Myb domain
SuperFamilySSF466892.57E-13251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-20244IPR009057Homeodomain-like
PfamPF002495.3E-15242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MTPQEELLVL QLHSKYGNRW SKIAGKLPGR TDNEIKNYWR THMRKQAQDE KKNTNKASIS  60
PSSSNCSSSS ANSPVEDFRT ERNELLQVAG ENKIYEGDQN MIVYSMDEIW KEVESTEEIE  120
TKNDLPAMAS NTWDYNYCPD SIWMSTHDHY YFDNHQDFSF FTG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.49820.0fruit| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g075660.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0130440.0Lycopersicon esculentum clone 114294R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310217.11e-120transcription factor MYB48-like
TrEMBLA0A3Q7HWX11e-119A0A3Q7HWX1_SOLLC; Uncharacterized protein
STRINGSolyc06g075660.2.11e-121(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.22e-29myb domain protein 48
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]