PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g075370.2.1
Common NameLOC101259641
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 304aa    MW: 33659.3 Da    PI: 7.5238
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g075370.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.54e-4039100263
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                         +e+a++cprCds+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Solyc06g075370.2.1  39 PEQAINCPRCDSSNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 100
                         6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.4E-344197IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-264296IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3764397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDPSSAQHQH HQELSSQTLE SMLVSTKPQQ QDPKKPKPPE QAINCPRCDS SNTKFCYYNN  60
YSLSQPRYFC KSCRRYWTKG GTLRNVPVGG GCRKNKRSSS SRSSSISSQD QHSIVNTPNN  120
PFPYDSSDLS LAFARLQKQG NGQLGFENHG NLSMMCNENP SGIFLDALRG NTGFLENNNP  180
MNGLIHQQNL YYGVGNIING DIGLHNVENG GLGVNNNDQE VGLMHNYDQE ISSGVTTSTT  240
MTTVKQEMCN MAKDQGDHNR VLWGFPWQIN GEGINMADFD STRRMWNGVG GSSWHGLLNS  300
PLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.92200.0callus| flower| fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g075370.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241265.10.0dof zinc finger protein DOF2.1
TrEMBLA0A3Q7H0C20.0A0A3Q7H0C2_SOLLC; Uncharacterized protein
STRINGSolyc06g075370.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.12e-38Dof family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]