PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g074170.2.1
Common NameLOC101255703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 410aa    MW: 46254.3 Da    PI: 8.9468
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g074170.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.72.8e-50321581128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWkatgk++
  Solyc06g074170.2.1  32 MFPGFRFSPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKER 121
                         579************************777.99***************667777899********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +v+s +++ +g+k+tLvf++grapkg++t+W+mhey +
  Solyc06g074170.2.1 122 NVKS-NSNIIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 158
                         ****.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5627175IPR003441NAC domain
PROSITE profilePS5100554.25532176IPR003441NAC domain
PfamPF023651.5E-2634157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MENEHVSSSS RNETTPRNNA NTEISIATAS SMFPGFRFSP TDEELISYYL KKKLEGSDKC  60
VEVISEVEIW KHEPWDLPAK SVIQSDNEWF FFSPRGRKYP NGSQSKRATE SGYWKATGKE  120
RNVKSNSNII GTKRTLVFHT GRAPKGQRTQ WIMHEYCMIG NTNYQDSMVV CRLRKNSEFH  180
LNDTPRNQRN QLVAIESATA LSGAGQLGSL ELVNVGECCS KEGSSSFHSH SVEQIDSGSE  240
SDKPTKEFSH HDSSGHFKDF DVEDDWFADI MKDDIIKLDD SSLNPRPVSM IPDRPESSEI  300
SNHEAQAAMS SVVPFQGTAN RRLRLVREIV MKCGVKESKP YKAIKKNKVG VGTTSSVRWL  360
RNMFSVKWMR QYVITIFVAT LIFLVMLLSL LGVSQQVKQR RHLLVLASS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-45231758164NO APICAL MERISTEM PROTEIN
1ut4_B2e-45231758164NO APICAL MERISTEM PROTEIN
1ut7_A2e-45231758164NO APICAL MERISTEM PROTEIN
1ut7_B2e-45231758164NO APICAL MERISTEM PROTEIN
3swm_A2e-452317511167NAC domain-containing protein 19
3swm_B2e-452317511167NAC domain-containing protein 19
3swm_C2e-452317511167NAC domain-containing protein 19
3swm_D2e-452317511167NAC domain-containing protein 19
3swp_A2e-452317511167NAC domain-containing protein 19
3swp_B2e-452317511167NAC domain-containing protein 19
3swp_C2e-452317511167NAC domain-containing protein 19
3swp_D2e-452317511167NAC domain-containing protein 19
4dul_A2e-45231758164NAC domain-containing protein 19
4dul_B2e-45231758164NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.62310.0cell culture
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g074170.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241333.10.0NAC domain-containing protein 40-like
TrEMBLA0A3Q7H0C40.0A0A3Q7H0C4_SOLLC; Uncharacterized protein
STRINGSolyc06g074170.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Representative plantOGRP10249610
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.13e-77NAC domain containing protein 89
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]