PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g073980.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 185aa    MW: 21098.5 Da    PI: 8.8778
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g073980.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.93.1e-1291182499
                         E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                  B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                         + +++++l+++rl lp +f + + + k+++ + tl++ ++ sW++     ++ +r  l++G ++F ++n L+++D++ Fkl+++++  l+v
  Solyc06g073980.2.1  91 IVIKASHLNRARLNLPAPFGNCYLKRKKRPLMATLRT-DSGSWTIVP---QYYDRLELREGIQKFIDDNALRVNDVCRFKLIDDEKLILKV 177
                         567899999***********88866667887777666.7779***99...3445677*************************999998888 PP

                         EEE-S CS
                  B3  95 kvfrk 99 
                         ++ r+
  Solyc06g073980.2.1 178 RIKRQ 182
                         88775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-1285181IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.4E-1185177IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.81188183IPR003340B3 DNA binding domain
CDDcd100171.16E-888181No hitNo description
SMARTSM010197.3E-889183IPR003340B3 DNA binding domain
PfamPF023621.7E-991182IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MVTPVEHVSI PHDLPEFFKI FHPEICYPQL FYVKIYGKNG CLKEDVTALK EPELLPLVEE  60
KARGKSIVAE PADQTDNGSG DMASSVTSFE IVIKASHLNR ARLNLPAPFG NCYLKRKKRP  120
LMATLRTDSG SWTIVPQYYD RLELREGIQK FIDDNALRVN DVCRFKLIDD EKLILKVRIK  180
RQPK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119LKRKKRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.119202e-44flower| fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g073980.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010322448.11e-135uncharacterized protein LOC101259943 isoform X2
TrEMBLM1A5L91e-105M1A5L9_SOLTU; Uncharacterized protein
STRINGSolyc06g073980.2.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA126331320
Representative plantOGRP1628723
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]