PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g073920.2.1
Common NameLOC101262319
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family YABBY
Protein Properties Length: 193aa    MW: 21347.1 Da    PI: 8.6049
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g073920.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY2321.4e-7191654170
               YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast 94 
                          ssse+vCyv+CnfC+tilavsvP +s++++vtvrCGhC++llsvn+a + q l+ ++ l+++ + ++ + +       + + ++++s+++
  Solyc06g073920.2.1   9 SSSSERVCYVHCNFCSTILAVSVPCNSMMTIVTVRCGHCANLLSVNIAPSLQSLPIQD-LQRQNESSIEDGM------SRGYGSSSSSTNS 92 
                         5799****************************************************99.5554444443333......2333444444444 PP

               YABBY  95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          ++ + +++  d++ pr pp ir PekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  Solyc06g073920.2.1  93 FHRFSPIPT--DHDQPRSPP-IRVPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 165
                         455555555..556688888.9****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046909.1E-7311165IPR006780YABBY protein
SuperFamilySSF470951.83E-8104158IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.2E-5112159IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSLDMTYSSS SSERVCYVHC NFCSTILAVS VPCNSMMTIV TVRCGHCANL LSVNIAPSLQ  60
SLPIQDLQRQ NESSIEDGMS RGYGSSSSST NSFHRFSPIP TDHDQPRSPP IRVPEKRQRV  120
PSAYNRFIKE EIQRIKASNP DISHREAFST AAKNWAHFPH IHFGLKLDGN KQTNKLDHAV  180
AGEGPQKTIG LY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.65880.0callus| floral bud| flower| fruit
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}.
UniprotTISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10457020}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g073920.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192191e-70Solanum lycopersicum chromosome 6 clone C06SLe0131F12, complete sequence
GenBankAC2328571e-70Solanum lycopersicum chromosome 6 clone C06HBa0055E14, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353825.11e-143putative axial regulator YABBY 2a
SwissprotQ9XFB04e-77YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A3Q7GZK71e-142A0A3Q7GZK7_SOLLC; Uncharacterized protein
STRINGSolyc06g073920.2.11e-143(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Representative plantOGRP22101236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-74YABBY family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]