PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g073210.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 233aa    MW: 26320.4 Da    PI: 8.6669
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g073210.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR161.42.7e-1950135290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +Y+eYA ++GF +r+ +s+ks+r+g+i++r + C     +++  +     +++r   r gC+a++ vk+ek g+w+v k++ +HnH+l+
  Solyc06g073210.2.1  50 YYDEYAGMTGFITRVLSSRKSERDGSIISRGLGCRGIPDNQRPVSL---VNQKRDRRRDGCTAMILVKREKPGTWVVRKFVRDHNHPLV 135
                         8*********************************876666666555...778888999*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.5E-1750135IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MTMDVHNLED NGAGRVESSA EGQVSTSEAD RTQEPNEGMT FESEEAARAY YDEYAGMTGF  60
ITRVLSSRKS ERDGSIISRG LGCRGIPDNQ RPVSLVNQKR DRRRDGCTAM ILVKREKPGT  120
WVVRKFVRDH NHPLVIPPSK RRPTSDEKDK RIQELTAELR TKKRLTAAYR EQLLSLMKDV  180
ESHSEHLSAK VQAVQSILKE LEAKRQELSN HSGHHKNSRV YTPVESDYDG TD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g073210.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241417.11e-160protein FAR1-RELATED SEQUENCE 2-like
TrEMBLA0A3Q7HVF21e-154A0A3Q7HVF2_SOLLC; Uncharacterized protein
STRINGSolyc06g073210.2.11e-173(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.12e-47FAR1 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]