PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g073200.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 126aa    MW: 14981.2 Da    PI: 10.3002
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g073200.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR144.64.8e-145484891
                FAR1 48 tekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                        +ek  r+raetr+gC+a++ v+k ++gkw+vtk+++eH+H+l+p
  Solyc06g073200.2.1  5 REKIVRQRAETRVGCRAMILVRKISSGKWVVTKFVKEHSHPLCP 48
                        367889************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.9E-11648IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MPDKREKIVR QRAETRVGCR AMILVRKISS GKWVVTKFVK EHSHPLCPGK GRRDLIYDQY  60
PNEHDKIREL SQQLAAEKKR SATYKRHLEM IFEHIEEHNQ SLSKKIQDIV HNVRELESRD  120
EHHHR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g073200.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241418.11e-87protein FAR1-RELATED SEQUENCE 5
RefseqXP_015077850.11e-87protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A0V0HLI08e-86A0A0V0HLI0_SOLCH; Uncharacterized protein
TrEMBLM1CKJ58e-86M1CKJ5_SOLTU; Uncharacterized protein
STRINGSolyc06g073200.2.11e-87(Solanum lycopersicum)
STRINGPGSC0003DMT4000694951e-86(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA115682325
Representative plantOGRP10299610
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.29e-66FAR1 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]