PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g073050.2.1
Common NameLOC101257973
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 596aa    MW: 65879.6 Da    PI: 4.9563
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g073050.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.92.8e-51191471128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp G+rF+Ptdeel+++yL+ k++g + ++  vi+e+di+k+ePwdLp  + v+++++ew++F++ d+ky++g+r nrat++gyWkatgkd
  Solyc06g073050.2.1  19 LPIGYRFRPTDEELINHYLCLKINGCHDQV-GVIREIDICKFEPWDLPdlSVVESNDNEWFYFCPIDRKYQNGQRLNRATERGYWKATGKD 108
                         699************************999.99**************96448888999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ ++kg+++g+kktLv+y+grap+g++t+Wv+heyr+
  Solyc06g073050.2.1 109 RNIATRKGAKIGMKKTLVYYNGRAPEGKRTNWVIHEYRA 147
                         *************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5714170IPR003441NAC domain
PROSITE profilePS5100553.78719170IPR003441NAC domain
PfamPF023652.3E-2420146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MTVTPVGNQV VEVPPLNTLP IGYRFRPTDE ELINHYLCLK INGCHDQVGV IREIDICKFE  60
PWDLPDLSVV ESNDNEWFYF CPIDRKYQNG QRLNRATERG YWKATGKDRN IATRKGAKIG  120
MKKTLVYYNG RAPEGKRTNW VIHEYRATDK SLDGSRPGQG AFVLCRLFKK NELKQAENVE  180
SSHFDEVEHL VSSPAVGISP TDDGLSAVAL SPIMESESNK SNPPKTSGCK THDTRLSIDS  240
CGNSCTAGDG EDLMVDITSG QPDLQIEELL GLFRDPSPEP IDWSPLHSQS QVEFGSSISH  300
GTMSNEINCD QKDVQCQNVI NDLNTNEFLN SILVSSDEFS YEDSEKELRS MWFASNSINT  360
ITTAPVTDSG TCSVLKSQVT QEPVRRDIFE PELLLGNCGE TALMREVNSV ATSVDEVFAT  420
PYFRNDHSMG NVGTDSAFGI TLRTRRTQNQ PDNSQPGSGM QGTTVRRIRY QVKLQTGRVE  480
RRMPTDSDQG GANHEGLSAV SESEKFSNED SSSLSAAISS DVTQDTMCKE LKGDRQMAED  540
LRSANVKDTN ALKRAALSSF SLSFYISKVF AVASLLIVFL GVCGFFKLRQ SASKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-451917515174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.52190.0callus| flower| fruit| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g073050.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135210.0Lycopersicon esculentum clone 132239F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001334624.10.0NAC domain-containing protein NACMTF3
TrEMBLA0A3Q7HVC40.0A0A3Q7HVC4_SOLLC; Uncharacterized protein
STRINGSolyc06g073050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Representative plantOGRP9409612
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.13e-84NAC domain containing protein 62
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]