PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g072890.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 265aa    MW: 29126.7 Da    PI: 5.2842
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g072890.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.57.1e-163797257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        r+R+++++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  Solyc06g072890.1.1 37 RSRWNPKPEQIVILESIFNSgMVNPRKDETVRIRKMLeqfgAVGDANVFYWFQNRRSRSRR 97
                        89*****************99*************************************997 PP

2Wus_type_Homeobox107.57.9e-353699265
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +r+RW+P+peQi iLe++++sG+++P k+e+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
  Solyc06g072890.1.1 36 VRSRWNPKPEQIVILESIFNSGMVNPRKDETVRIRKMLEQFGAVGDANVFYWFQNRRSRSRRRQ 99
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-81898IPR009057Homeodomain-like
SuperFamilySSF466899.84E-1431104IPR009057Homeodomain-like
PROSITE profilePS5007111.3053398IPR001356Homeobox domain
SMARTSM003892.8E-535102IPR001356Homeobox domain
PfamPF000461.3E-133797IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MIIPFFDVIL EFYLFHSAMD DDSSSSSQSC ERNETVRSRW NPKPEQIVIL ESIFNSGMVN  60
PRKDETVRIR KMLEQFGAVG DANVFYWFQN RRSRSRRRQR QIQASLSAVS NSNEEQSARS  120
SDGGAIQFQT NFVPSSVSSS SSSLGGVVGN ANDGLFLFSG PMGIDQNSSI TSILCSPTDN  180
SNLNCSSSGF ITVFINGVAA QVPRGPLDMK AMFGPEDLVL YHSSGVPLPV NEYGFVVQSL  240
QHGESYFLAC PCILLYTHVT LYIL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g072890.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010322493.10.0WUSCHEL-related homeobox 11 isoform X2
RefseqXP_025887450.10.0WUSCHEL-related homeobox 11 isoform X2
SwissprotQ6X7J33e-61WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLM1CKL81e-129M1CKL8_SOLTU; Uncharacterized protein
STRINGSolyc06g072890.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61662231
Representative plantOGRP46971222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.18e-61WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  3. Sheng L, et al.
    Non-canonical WOX11-mediated root branching contributes to plasticity in Arabidopsis root system architecture.
    Development, 2017. 144(17): p. 3126-3133
    [PMID:28743799]
  4. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]
  5. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]