PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g071230.2.1
Common NameLES1_20t00004, LOC101261036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 303aa    MW: 32981.8 Da    PI: 9.8868
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g071230.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.8e-1498142347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Solyc06g071230.2.1  98 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 142
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.99791147IPR017930Myb domain
SuperFamilySSF466894.64E-1793148IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-1794145IPR006447Myb domain, plants
SMARTSM007171.8E-1095145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-1197142IPR009057Homeodomain-like
PfamPF002491.7E-1198142IPR001005SANT/Myb domain
CDDcd001671.70E-998143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSSVCSDKSS STPAVTGGGF GGEIMLFGVR VKVDPMRKSV SLNDLSQYEQ PNANNNNNNG  60
GGDNNESSKV AQDEGYASAD DAVQHQSNSG RERKRGVPWT EEEHKLFLLG LQKVGKGDWR  120
GISRNFVKTR TPTQVASHAQ KYFLRRSNLN RRRRRSSLFD ITTDSVSVMP IEEVENKQEI  180
PVPAPATLPP VETTKTNAFS VAPAVAPIIF PVQVNKSREN PTLFRHDHAN SSMLVGPVPM  240
FSMPNPSKSI DLNANHNSTI EPSSLSLRLS LSLDQGQASS TRHSAYNVMS SFSNGESIIR  300
VA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.194710.0callus| flower| fruit| leaf| root| seed| stem
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00149DAPTransfer from AT1G19000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g071230.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1600950.0Solanum lycopersicum clone BB, complete sequence
GenBankAC2095110.0Solanum lycopersicum chromosome 6 clone C06HBa0153G23, complete sequence
GenBankAY7961140.0Lycopersicon esculentum clone Le_HBa 153G23 putative transposase, putative BAH domain-containing protein, putative permease I, putative pollen specific LIM domain-containing protein, putative betaine aldehyde dehyrogenase, EDS1, and putative ribosomal-protein S6 kinase-like protein genes, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001307462.10.0transcription factor MYB1R1
SwissprotQ2V9B01e-167MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLQ53J250.0Q53J25_SOLLC; Putative DNA binding protein, identical
STRINGSolyc06g071230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.21e-60MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]