PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g069760.2.1
Common NameSlDof22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 493aa    MW: 53491.7 Da    PI: 6.5082
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g069760.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1161.5e-36140199261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         ++k+l+cprC+s +tkfCyynn +++qPr+fC++C+ryWt+GG++rn+PvG+grrknk+ 
  Solyc06g069760.2.1 140 PDKILPCPRCNSLDTKFCYYNNNNVNQPRHFCRSCQRYWTAGGTMRNLPVGAGRRKNKNL 199
                         7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-28137197IPR003851Zinc finger, Dof-type
PfamPF027017.2E-31142198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.773144198IPR003851Zinc finger, Dof-type
PROSITE patternPS013610146182IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MTCDSEIKLF GKILPVVVSG VGRGLSGSDG VIYDGNRNGS DLDRCLEGSK ASSVEKDEGS  60
EYEKQEAEKD NITGELSEAK SEEGDQNQMI EESENPKTPS ESESSPKSST EEDPQAVKSS  120
KTENEPTNVT NSEQNNLKKP DKILPCPRCN SLDTKFCYYN NNNVNQPRHF CRSCQRYWTA  180
GGTMRNLPVG AGRRKNKNLA SQYRNISIPE GLLAAGIESP NGLIHHPLFK PNGTILSFGP  240
DLPLCEPMAS ALNQAEKRVS TGIQNGSHKS EVKNSSCKGG DSGDECCRGI NIPTPNMMVE  300
EGKGEPHKAV MHSINGIPSP VPCLHGVPWP FPWNAAVPVS AICPIPFPMP FFPTPYWNCS  360
VPPWSNPWLS PPLRAANEKT SGSDPTSSLG KHSREGDLLK PSNPGGKEQS EQKYSEGSIL  420
VPKTLRIDDP DEAAKSSIWS TLGIKYDSTN RGEFFKALQP KSNDKHNKAN TFPVLHTNPA  480
ALSRSITFQQ GA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.85500.0callus| flower| fruit| leaf
Function -- GeneRIF ? help Back to Top
  1. Overexpression in Arabidopsis of SlCDF3 but not SlCDF1 promotes late flowering through modulation of the expression of flowering control genes such as CO and FT. Data connects SlCDFs to undescribed functions related to abiotic stress tolerance and flowering time through the regulation of specific target genes and an increase in particular metabolites. [SlCDF3]
    [PMID: 24399177]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g069760.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001315363.10.0Dof zinc finger protein 22
TrEMBLA0A3Q7GYI80.0A0A3Q7GYI8_SOLLC; Uncharacterized protein
STRINGSolyc06g069760.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-76cycling DOF factor 3
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Corrales AR, et al.
    Characterization of tomato Cycling Dof Factors reveals conserved and new functions in the control of flowering time and abiotic stress responses.
    J. Exp. Bot., 2014. 65(4): p. 995-1012
    [PMID:24399177]
  3. Cai X, et al.
    The transcription factor SlDof22 involved in ascorbate accumulation and salinity stress in tomato.
    Biochem. Biophys. Res. Commun., 2016. 474(4): p. 736-41
    [PMID:27157141]