PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g069710.2.1
Common NameLOC101255705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 340aa    MW: 38049.3 Da    PI: 8.049
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g069710.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.24.5e-55161421129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL +kv ++++ +  +i +vd++kvePwdLp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkd+e
  Solyc06g069710.2.1  16 LPPGFRFHPTDEELITHYLSNKVVDTNFVA-IAIGDVDLNKVEPWDLPWKAKMGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKATGKDRE 105
                         79*************************988.78***************888999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++ +++lvg+kktLvfykgrapkgekt+Wv+he+rle
  Solyc06g069710.2.1 106 IFR-GKSLVGMKKTLVFYKGRAPKGEKTNWVIHEFRLE 142
                         ***.999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6213166IPR003441NAC domain
PROSITE profilePS5100558.48616166IPR003441NAC domain
PfamPF023658.5E-2817141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MENYSGVVKD DDQMELPPGF RFHPTDEELI THYLSNKVVD TNFVAIAIGD VDLNKVEPWD  60
LPWKAKMGEK EWYFFCVRDK KYPTGLRTNR ATAAGYWKAT GKDREIFRGK SLVGMKKTLV  120
FYKGRAPKGE KTNWVIHEFR LEGKLSLQNL PKTAKNEWVI CRVFQKSSGG KKIHISGLLK  180
LNSNENEMGN SFLPPLTDSA TATASKSSHV HCFSNFLTAQ NNCFPLLSNP MDSYPTTSLV  240
PNTFSCNQIA PFTTTNNPAS FGVQDPSILL RTSLDSYGLN FKKEDIFNVP QETGVISTDM  300
NTDITSVVSN LEMKRRFLED QVPSAGMVGL QGLDCLWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-531317214171NO APICAL MERISTEM PROTEIN
1ut4_B1e-531317214171NO APICAL MERISTEM PROTEIN
1ut7_A1e-531317214171NO APICAL MERISTEM PROTEIN
1ut7_B1e-531317214171NO APICAL MERISTEM PROTEIN
3swm_A2e-531317217174NAC domain-containing protein 19
3swm_B2e-531317217174NAC domain-containing protein 19
3swm_C2e-531317217174NAC domain-containing protein 19
3swm_D2e-531317217174NAC domain-containing protein 19
3swp_A2e-531317217174NAC domain-containing protein 19
3swp_B2e-531317217174NAC domain-containing protein 19
3swp_C2e-531317217174NAC domain-containing protein 19
3swp_D2e-531317217174NAC domain-containing protein 19
4dul_A1e-531317214171NAC domain-containing protein 19
4dul_B1e-531317214171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g069710.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241586.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-125NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A3Q7GYH50.0A0A3Q7GYH5_SOLLC; Uncharacterized protein
STRINGSolyc06g069710.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-123NAC domain containing protein 100
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]