PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g069100.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 498aa    MW: 56356.6 Da    PI: 6.5917
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g069100.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.34.3e-55141401128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhP+deel+++yL +kv++ ++++ ++i++vd++k+ePwdLp+k + +ekewyfFs++d+ky+tg r+nrat++gyWk+tgkdke
  Solyc06g069100.1.1  14 LPPGFRFHPSDEELITYYLSNKVSDFSFTT-RAIADVDLNKSEPWDLPAKSSMGEKEWYFFSQKDRKYPTGLRSNRATEAGYWKTTGKDKE 103
                         79*************************999.89***************988899************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ + elvg+kktLvfykgrapkgekt+Wvmheyrl
  Solyc06g069100.1.1 104 IFRGGVELVGMKKTLVFYKGRAPKGEKTNWVMHEYRL 140
                         ***99999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-626161IPR003441NAC domain
PROSITE profilePS5100559.83714161IPR003441NAC domain
PfamPF023652.4E-2815140IPR003441NAC domain
PfamPF056785.6E-11337361IPR008889VQ
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MMIEQYNIMD EKNLPPGFRF HPSDEELITY YLSNKVSDFS FTTRAIADVD LNKSEPWDLP  60
AKSSMGEKEW YFFSQKDRKY PTGLRSNRAT EAGYWKTTGK DKEIFRGGVE LVGMKKTLVF  120
YKGRAPKGEK TNWVMHEYRL QSNLGFKPPK EEWVVCRLFH KNSTVKKSNA TSSQPSDQVE  180
SISDAYTLPN FNIPAPHEGQ IVNDISLHNY YTSQENMNIV NLDPLPSLLL YKAIQCRGNY  240
NHQPMNIDPS INTMNHAQFY HHTNSNQAIV NNNNNNNLSS PLKINKASHH IKKSLSNSLP  300
SSSSSSSLYN TVAATTSTTI IPHQQQQQQR QPVIIYTHSP KVIHTHPRDF KALVQKLTGL  360
SPEEVSSSPQ SMPMPQYHPK SEPINGEMDH DHDTIIGAES CFGDEQNNYH RNNMTNINTN  420
INEKCDLLMN DDNDSVVTDE NNEFNGSSCI GDNNSSASCY VPHQQLSNYT DSLFSMPSMR  480
NSFSSSSSES IKELPDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-5511674171NO APICAL MERISTEM PROTEIN
1ut4_B9e-5511674171NO APICAL MERISTEM PROTEIN
1ut7_A9e-5511674171NO APICAL MERISTEM PROTEIN
1ut7_B9e-5511674171NO APICAL MERISTEM PROTEIN
3swm_A1e-5411677174NAC domain-containing protein 19
3swm_B1e-5411677174NAC domain-containing protein 19
3swm_C1e-5411677174NAC domain-containing protein 19
3swm_D1e-5411677174NAC domain-containing protein 19
3swp_A1e-5411677174NAC domain-containing protein 19
3swp_B1e-5411677174NAC domain-containing protein 19
3swp_C1e-5411677174NAC domain-containing protein 19
3swp_D1e-5411677174NAC domain-containing protein 19
4dul_A9e-5511674171NAC domain-containing protein 19
4dul_B9e-5511674171NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g069100.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2326223e-18Solanum lycopersicum chromosome 7 clone C07HBa0025K11, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242189.20.0NAC domain-containing protein 79
TrEMBLA0A3Q7GXB20.0A0A3Q7GXB2_SOLLC; Uncharacterized protein
STRINGSolyc06g069100.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.16e-92NAC domain containing protein 58
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]