PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g066180.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 184aa    MW: 20394.3 Da    PI: 10.4324
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g066180.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-321872155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLH++Fv+av++LGG++kAtPk +l+lm++kgLtl+h+kSHLQkYRl
  Solyc06g066180.2.1 18 KPRLRWTAELHQQFVDAVTKLGGPDKATPKLVLRLMGLKGLTLYHLKSHLQKYRL 72
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-311572IPR009057Homeodomain-like
PROSITE profilePS5129412.9531575IPR017930Myb domain
TIGRFAMsTIGR015571.6E-231873IPR006447Myb domain, plants
SuperFamilySSF466893.4E-161873IPR009057Homeodomain-like
PfamPF002491.2E-92071IPR001005SANT/Myb domain
PfamPF143793.5E-11118151IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MGSNLYENDG VVMTRDPKPR LRWTAELHQQ FVDAVTKLGG PDKATPKLVL RLMGLKGLTL  60
YHLKSHLQKY RLGQLAKKQN AAEANKENSG DSSGQFGLHS SGPSTSSLSM NFMQGEVPTT  120
EAVMSQIQVQ KILQEQLQVQ QKLQMRIEAQ GSNNLSSPCF RFTSVKFNGL WREPGLQHRA  180
TNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-191871154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-191871154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-191871154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-191871154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.231460.0fruit| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g066180.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092623e-31Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0006A17, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010322712.11e-107myb family transcription factor PHL11
SwissprotC0SVS43e-57PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A3Q7GZC38e-94A0A3Q7GZC3_SOLLC; Uncharacterized protein
STRINGSolyc06g066180.2.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-35G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]