PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g062520.1.1
Common NameLOC101260544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 193aa    MW: 20973.9 Da    PI: 8.275
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g062520.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57.2e-391877362
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ++ lkcprCds ntkfCyynny+lsqPr+fCk+C+ryWtkGG lrn+PvGg++rkn k+s
  Solyc06g062520.1.1 18 QQVLKCPRCDSINTKFCYYNNYNLSQPRHFCKNCKRYWTKGGILRNIPVGGSSRKNTKRS 77
                        6889****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-24968IPR003851Zinc finger, Dof-type
PfamPF027011.6E-331975IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6212175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MQDPSSIYSQ INPQFPDQQV LKCPRCDSIN TKFCYYNNYN LSQPRHFCKN CKRYWTKGGI  60
LRNIPVGGSS RKNTKRSSSN SCKRSSTMTI SSSTSSEQNS KTEHFDTPVV RNSPIVDANG  120
PFGSLLASNG PEIGNFLNVL NPNGPDSGSD AAAAQSGNSN NNHEFLGEDS NCWNGTNGWA  180
DLAIYTPGST FQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.118400.0flower| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g062520.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192240.0Solanum lycopersicum chromosome 6 clone C06SLm0074G21, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241941.11e-141dof zinc finger protein DOF3.1
SwissprotO821551e-40DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A3Q7GVI91e-139A0A3Q7GVI9_SOLLC; Uncharacterized protein
STRINGSolyc06g062520.1.11e-140(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-34DOF zinc finger protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]