PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g061080.2.1
Common NameLOC101244385
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 338aa    MW: 38107.6 Da    PI: 5.7791
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g061080.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.14e-5461331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtd+elv +yLk+k+++ ++el evi+ +d+yk++PwdLp k  + +++ ewyfF++rdkky++g+r+nrat+sgyWkatgkd
  Solyc06g061080.2.1   6 LPPGFRFHPTDQELVGYYLKRKTDELEIEL-EVIPVIDLYKFDPWDLPeKsFLPKRDMEWYFFCSRDKKYPNGSRTNRATNSGYWKATGKD 95 
                         79****************************.99**************95344555788********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         k+v++ k+++vg +ktLvfy+grap g +tdWvmheyrl
  Solyc06g061080.2.1  96 KKVVC-KSAVVGYRKTLVFYRGRAPLGDRTDWVMHEYRL 133
                         *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-614156IPR003441NAC domain
PROSITE profilePS5100557.9286156IPR003441NAC domain
PfamPF023651.7E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MAGISLPPGF RFHPTDQELV GYYLKRKTDE LEIELEVIPV IDLYKFDPWD LPEKSFLPKR  60
DMEWYFFCSR DKKYPNGSRT NRATNSGYWK ATGKDKKVVC KSAVVGYRKT LVFYRGRAPL  120
GDRTDWVMHE YRLCDDVSQG TPSFQGPFAL CRVIKRKDNI PSKTSDVHGG TVFKQVECSS  180
SIEGFTSTVA LNEPLLLSND MPTPSTYMSG NSNYSTPTNS PYKITQIEDY DSANLWMPQN  240
KVLDPSKECP QGRSISGNYP HMFSNSTSWQ PSDQYDFTSS SSFPNFRGEV ELSGDLSGYG  300
NVSPFSVDGS CMEFYGSGEI SYKGYNQNDL LGNPYLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-51115912168NO APICAL MERISTEM PROTEIN
1ut4_B5e-51115912168NO APICAL MERISTEM PROTEIN
1ut7_A5e-51115912168NO APICAL MERISTEM PROTEIN
1ut7_B5e-51115912168NO APICAL MERISTEM PROTEIN
3swm_A7e-51115915171NAC domain-containing protein 19
3swm_B7e-51115915171NAC domain-containing protein 19
3swm_C7e-51115915171NAC domain-containing protein 19
3swm_D7e-51115915171NAC domain-containing protein 19
3swp_A7e-51115915171NAC domain-containing protein 19
3swp_B7e-51115915171NAC domain-containing protein 19
3swp_C7e-51115915171NAC domain-containing protein 19
3swp_D7e-51115915171NAC domain-containing protein 19
3ulx_A7e-51213311140Stress-induced transcription factor NAC1
4dul_A5e-51115912168NAC domain-containing protein 19
4dul_B5e-51115912168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.70871e-119callus| fruit| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, rosettes leaves, cauline leaves and stems. {ECO:0000269|PubMed:24285786}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in the positive regulation of abscisic acid (ABA) responsive genes. Acts as a positive factor of ABA-mediated responses. Involved in the transcriptional activation of ABA-inducible genes in response to dehydration and osmotic stresses. Plays a positive role in both stomatal closure and water loss under dehydration stress conditions. Acts synergistically with ABF2 to activate the dehydration stress-response factor RD29A transcription. Binds to the consensus core cis-acting elements 5'-CGTA-3' and 5'-CACG-3' at the RD29A promoter (PubMed:24285786). Involved in hypocotyl graft union formation. Required for the auxin-mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:25182467). {ECO:0000269|PubMed:24285786, ECO:0000269|PubMed:25182467}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g061080.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and osmotic stress. {ECO:0000269|PubMed:24285786}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1583080.0Solanum lycopersicum AFLP fragment TGG2, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241972.10.0NAC domain-containing protein 71
SwissprotQ9LS248e-87NAC96_ARATH; NAC domain-containing protein 96
TrEMBLA0A3Q7GVA00.0A0A3Q7GVA0_SOLLC; Uncharacterized protein
STRINGSolyc06g061080.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.14e-77NAC domain containing protein 96
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]