PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g061030.2.1
Common NameLOC101245957
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 560aa    MW: 62309.3 Da    PI: 6.6624
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g061030.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.31.1e-25314367155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k +++WtpeLH++Fv+ave++ G+++A+P++ilelmkv+gLt+++++SHLQk+R+
  Solyc06g061030.2.1 314 KMKVDWTPELHKKFVKAVEKI-GIDQAIPSRILELMKVEGLTRHNIASHLQKFRM 367
                         5689*****************.********************************8 PP

2Response_reg34.61e-12201261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+ d + ++++ +r+ l++ +y +v ++ +  eal  +  k   +++ ++ ++  ++dG   +k +++++ +lp i+v++  + + + ++
  Solyc06g061030.2.1  20 VLLLDTDSNFASQMRSRLQQMDY-IVYTFCNENEALSAISSKSevFHVAIVEVSAGNSDG--GFKFLESAK-DLPTIMVSDIHSINIMMKC 106
                         7999*******************.***************777778************776..344444544.89***************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         + +Ga +fl Kp + ++l++
  Solyc06g061030.2.1 107 IALGAVEFLQKPLSDDKLRN 126
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.2E-1516134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.2E-1616157No hitNo description
SMARTSM004481.6E-618128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011020.76319132IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.1E-920127IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.68E-1021131No hitNo description
PROSITE profilePS5129414.174311370IPR017930Myb domain
SuperFamilySSF466893.4E-17312371IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-25312371IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-24314368IPR006447Myb domain, plants
PfamPF002491.3E-6317365IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MVCTENELLE WKDFPKGLKV LLLDTDSNFA SQMRSRLQQM DYIVYTFCNE NEALSAISSK  60
SEVFHVAIVE VSAGNSDGGF KFLESAKDLP TIMVSDIHSI NIMMKCIALG AVEFLQKPLS  120
DDKLRNIWQH VVHKAFHSGG KSVSESLKPV KESLLSILEL QPVKHEADNE NTNEAEPLIS  180
VVENQKASSS CCDKYPAPST PQQKQGVRSV DDVDYQDHTI LSNEQDSGMH EGDTKSVETT  240
SCDSVAETTV LADSSERLGE AITKEEHYSA ADQHMEDPIA TCSPSNDNGS TCSADPNKAS  300
GLHSSSGTKA NKKKMKVDWT PELHKKFVKA VEKIGIDQAI PSRILELMKV EGLTRHNIAS  360
HLQKFRMQRK QILPKEDERR WPRPQPRDPV QRTYYPHKPV MAFPTHHSNH ATTAGQFYPA  420
WIPPGGYPNG AHMWNSPYYH GWQPPETWHW NPQPGLYADV WGCPVTPPSL GSCTPYPQNA  480
SGFHRAEGML NGYSIIQKSV DLHPAEEVID KVVKEAINKP WLPLPLGLKP PSTESVLDAL  540
SKQGIPAVPP RHHRSHRPH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-16312372363ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.128400.0fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g061030.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2260150.0Solanum lycopersicum chromosome 6 clone C06SLm0047M23, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241977.10.0two-component response regulator-like APRR2
RefseqXP_010322878.10.0two-component response regulator-like APRR2
SwissprotQ6LA431e-135APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A3Q7GV890.0A0A3Q7GV89_SOLLC; Uncharacterized protein
STRINGSolyc06g061030.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56731531
Representative plantOGRP9166813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-138ARR-B family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]