PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g060230.2.1
Common NameNAM1, SlNAM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 297aa    MW: 33924.5 Da    PI: 7.2481
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g060230.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.7e-5281321128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelv++yL++k++++++ +  +++e+d+yk++PwdLp  +  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+
  Solyc06g060230.2.1   8 LPPGFRFHPTDEELVTHYLCRKCTSQPIAV-PIVAEIDLYKFDPWDLPDLALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKP 97 
                         79*************************999.88***************65556799*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + +   ++vg+kk Lvfy+g+apkgekt+W+mheyrl
  Solyc06g060230.2.1  98 IGN--PKAVGIKKALVFYSGKAPKGEKTNWIMHEYRL 132
                         *98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-634159IPR003441NAC domain
PROSITE profilePS5100561.0258159IPR003441NAC domain
PfamPF023654.0E-289132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MTAAELQLPP GFRFHPTDEE LVTHYLCRKC TSQPIAVPIV AEIDLYKFDP WDLPDLALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGTGYWK ATGADKPIGN PKAVGIKKAL VFYSGKAPKG  120
EKTNWIMHEY RLADVDRSAR KNNNSLRLDD WVLCRIYNKK GSIEKNRKMN TTCYMDKVGS  180
PEDRKPEILP PLPPHPQPQQ LHNDFFYLPS DSVPKMHSDS SCSEHVLSPE FTCEREVQSE  240
PKLTDWEKAT LDLPFNYMDA TTGATTVDNS LLGSQFQSSY QMSPLQDMFM HLHKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-82416511174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.191190.0callus| fruit| leaf| root| seed
Function -- GeneRIF ? help Back to Top
  1. These results indicated that overexpression of SlNAM1 could improve chilling stress tolerance of transgenic tobacco.
    [PMID: 27518221]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g060230.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6707490.0Solanum lycopersicum cultivar LA2711 Nam-like protein 1 (SlNAM1) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234219.10.0Nam-like protein 1
SwissprotQ390131e-139NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB6D1Q30.0B6D1Q3_SOLLC; Nam-like protein 1
STRINGSolyc06g060230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-137NAC family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ouyang B, et al.
    Identification of early salt stress response genes in tomato root by suppression subtractive hybridization and microarray analysis.
    J. Exp. Bot., 2007. 58(3): p. 507-20
    [PMID:17210988]
  3. Yang R,Deng C,Ouyang B,Ye Z
    Molecular analysis of two salt-responsive NAC-family genes and their expression analysis in tomato.
    Mol. Biol. Rep., 2011. 38(2): p. 857-63
    [PMID:20443064]
  4. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  5. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  6. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  7. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  8. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  9. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  10. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  11. Li XD, et al.
    Overexpression of a novel NAC-type tomato transcription factor, SlNAM1, enhances the chilling stress tolerance of transgenic tobacco.
    J. Plant Physiol., 2016. 204: p. 54-65
    [PMID:27518221]
  12. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  13. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]