PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g053350.2.1
Common NameLOC101268111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 435aa    MW: 47522.6 Da    PI: 6.4107
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g053350.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.8e-10226284563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l +e+
  Solyc06g053350.2.1 226 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSTQLTLLQRDTNGLNAEN 284
                         9********************************************99998877776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-15222286IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932224287IPR004827Basic-leucine zipper domain
PfamPF001705.6E-9226282IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11226277No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-10226280No hitNo description
CDDcd147038.85E-19227263No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MDKDKSSSSH IGGSLPPSGR YSLFSPPGSS SNVKSEQPGL ANLPPLGPGN ASESGHFGHG  60
LSADSSLFSL DISRMSDNPP RKFGHRRAHS EILTLPDDIS FDSDLGVVGL DGPSLSDETE  120
EDILSMYLDM DKFNSSTLSS EFQVGESSSA APGSSQTTAM ASGTNKFAPT VSEKPRVRHQ  180
HSQSMDGSTT IKPEMLMSGV EEPSSAETKK ATSAAKLAEL ALIDPKRAKR IWANRQSAAR  240
SKERKMRYIA ELERKVQTLQ TEATTLSTQL TLLQRDTNGL NAENSELKLR LQTMEQQVHL  300
QDALNDALKE EIQHLKVLTG QGIANGGPMM NFPATFGGNQ QFYSNNQAMH TLLAAQQLQQ  360
LQLHSHKQQH QFQQHQLHQF QQQQLQHQQQ QQQPLMQQQQ QQDQLSQAGD VMSRGSLSSP  420
QNENASDVSS VAKD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.51940.0callus| flower| fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g053350.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0134850.0Lycopersicon esculentum clone 132168R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025887292.10.0probable transcription factor PosF21
RefseqXP_025887293.10.0probable transcription factor PosF21
SwissprotQ040881e-146POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0V0INP20.0A0A0V0INP2_SOLCH; Putative transcription factor PosF21-like
STRINGSolyc06g053350.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39652137
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-125bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]