PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g049040.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 332aa    MW: 36705.8 Da    PI: 6.4451
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g049040.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.8e-10140195560
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                         kr++r   NR +A rs +RK  +i eLe+kv++L+ae ++L  +l   +++  kl+
  Solyc06g049040.2.1 140 KRAKRILANRQSAARSKERKTRYISELERKVQTLQAEATTLSTQLTLFQNTELKLR 195
                         9*****************************************99998888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-12136200IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.99138195IPR004827Basic-leucine zipper domain
PfamPF001702.8E-9140197IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.34E-10140190No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-10140196No hitNo description
CDDcd147035.69E-21141190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MQDPSNPNSI KLPTTTFSAA FRPSHHRRAH SEVNFRLPED LDLVSDPFDA PAGSFEEIGS  60
EDDFFSTYMD IEKLASGSNL TDIDAAAARV GVESSDGEKK PRHRHSNSVD SSSLLMTESI  120
EAKKAMAPDK LAELWTIDPK RAKRILANRQ SAARSKERKT RYISELERKV QTLQAEATTL  180
STQLTLFQNT ELKLRLQAME QQAQLRDALN EALKQEVERL KIATGQISAS SDAYSSGMQQ  240
IQYNRPAFFP HQTQPGPSES HNIQMSQFHH LQDSMSNPRH PLLSGNVQAL ADAMQQDPVG  300
RFQGLDISSR GSHLVKSEAP SISASESSTT F*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g049040.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0145762e-12Lycopersicon esculentum clone 134031F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240865.10.0transcription factor RF2b-like
SwissprotO228731e-101BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A3Q7GV720.0A0A3Q7GV72_SOLLC; Uncharacterized protein
STRINGSolyc06g049040.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34252349
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-101bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  4. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  6. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]