PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g048630.2.1
Common NameLOC101248981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 350aa    MW: 38644.8 Da    PI: 6.2941
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g048630.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.42.1e-10150206561
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                         kr++r   NR +A+rs +RK  +i eLe+kv++L++e ++L  +l   +    + ++
  Solyc06g048630.2.1 150 KRAKRILANRQSASRSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDTTQFTN 206
                         9*****************************************999877766666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-16146210IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737148211IPR004827Basic-leucine zipper domain
PfamPF001701.0E-8150198IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.8E-8150196No hitNo description
SuperFamilySSF579591.69E-10150201No hitNo description
CDDcd147032.76E-22151200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MQDPSNPNSK QLNQTPPFSA TFRPSHHRRA HSEVNFRLPE DLDLVSDPFD ASAGSFEEIG  60
SEDDFFSTYM DIEKLGSGSN PTDVPGFNNA GAGSSGLVAD CGDGERNFTR PRHRHSNSVD  120
SSSLLLSESI EAKKAMAPDK LAELWTIDPK RAKRILANRQ SASRSKERKA RYITELERKV  180
QTLQTEATTL SAQLTLFQRD TTQFTNENTE LKLRLQAMAQ QAQLRDALNE ALKQEVERLK  240
MATGEMSSSD AYNLGMQHIP YNQSAFFSHQ PQSGASESQN IQMQQFHSLQ DSLLTPHRRL  300
LAGHGQGLPD TMQQDPLGRF QGLDIGGRGL HLVKTETPSI SASESSSTL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.74990.0callus| flower| fruit| leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g048630.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240847.10.0transcription factor RF2b
RefseqXP_015080176.10.0transcription factor RF2b
SwissprotO228731e-117BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A3Q7GUZ50.0A0A3Q7GUZ5_SOLLC; Uncharacterized protein
STRINGSolyc06g048630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34252349
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.14e-98bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  4. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  6. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]