PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g036300.2.1
Common NameLOC101259846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 302aa    MW: 33294.2 Da    PI: 10.3462
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g036300.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.3e-125094147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Solyc06g036300.2.1 50 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 94
                        789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-1644100IPR009057Homeodomain-like
PROSITE profilePS5129414.184599IPR017930Myb domain
TIGRFAMsTIGR015571.4E-184897IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.0E-648100IPR009057Homeodomain-like
SMARTSM007176.5E-104997IPR001005SANT/Myb domain
PfamPF002494.3E-105094IPR001005SANT/Myb domain
CDDcd001671.08E-75295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MVMALPNLGS FSNPTATASA AATPSASNPL SPSDDPSKKI RKPYTITKSR ESWTEPEHDK  60
FLEALQLFDR DWKKIEAFVG SKTVIQIRSH AQKYFLKVQK SGTNEHLPPP RPKRKAAHPY  120
PQKATKSAAP AVSLVPTSFQ ASLPLPEPGI VKRPDSSLLP SNAAPVVSVP SWTDNSAPPV  180
SLSQMKKDKV RETGQPITNN RCCSSNGSTP RSKSTVKVME RTQVPSLRVL PDFAQVYNFI  240
GSVFDPAVTG HLQKLKKMDR IDVETVLLLM RNLSINLTSP DFEHHRQLLS SYDIEMEKQC  300
K*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.99520.0fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g036300.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240716.10.0protein REVEILLE 6 isoform X1
SwissprotQ8H0W31e-106RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A3Q7GUK40.0A0A3Q7GUK4_SOLLC; Uncharacterized protein
STRINGSolyc06g036300.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-93MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]