PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g034030.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 329aa    MW: 36089.9 Da    PI: 10.625
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g034030.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.32.4e-10103147347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + + lG+g+W+ I+++    Rt+ q+ s+ qky
  Solyc06g034030.2.1 103 SWTEEEHRYFLIGLENLGKGDWRGISKRYVPSRTPTQVASHSQKY 147
                         7*************************99999************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.565621IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129415.86796152IPR017930Myb domain
SuperFamilySSF466892.11E-1697152IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-1499150IPR006447Myb domain, plants
SMARTSM007171.4E-6100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-10100143IPR009057Homeodomain-like
CDDcd001674.96E-7103143No hitNo description
PfamPF002492.8E-8103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAKDARKCSH CGHNGHNSRT CNSKGIKLFG VRIDDSNNTN QHRFVDTKMK MGDYESIRRS  60
KSLGNLEHAA AAAANYDHNG GVEAGYLSDG PIISIRHRKK GTSWTEEEHR YFLIGLENLG  120
KGDWRGISKR YVPSRTPTQV ASHSQKYFIR IASIEKKKRR PSVFDVHLKN PNSHIPSKSS  180
SYIPEVSKET SFPLKQLFDT CQIKGQASKG IPSATRERPP LSPSPISRPF GVPNLAHMPY  240
VGVPQNIQGV SSSKVGPTIS WIPIVNFHNE SRVHLKNSSQ GPLPFAPFVA RPTIGVLPSQ  300
PPSQVQSQPG HSTPITNKDG VNIIIGAL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155159KKKRR
2155160KKKRRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g034030.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2402234e-07Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-56g22 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240766.30.0probable transcription factor At5g61620 isoform X2
TrEMBLA0A3Q7GTK60.0A0A3Q7GTK6_SOLLC; Uncharacterized protein
STRINGSolyc06g034030.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117831823
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-48MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]