PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g009610.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 865aa    MW: 98029.8 Da    PI: 5.3106
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g009610.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.69.2e-934948621374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPi 90 
                         lv+lLl++Ae v++++++la++ +a+    as +g+p+qRl +yf eAL++r+ r  + + +   + +  s+    ++  +l + +   P+
  Solyc06g009610.1.1 494 LVHLLLAAAEEVDQQQFHLASQSIAHCLWKASATGNPIQRLCFYFGEALQERIDReIGRSPCFERKLRFLSTLALGNTPESL-TCHTEIPF 583
                         68*****************************************************322221111222222222233333333.355667** PP

                GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          ++ +++ NqaI+e v+g++++H +Df+i  G+QW  L+qaL++R++ p   l+iT++g+   ++k+++eetg+rL++fA++l++pf+f++
  Solyc06g009610.1.1 584 SQVMQFAGNQAIVEYVKGATKIHLVDFNIRSGIQWTGLMQALSERRNCPIeLLKITAIGH---QEKQKIEETGKRLQSFANSLNLPFSFDM 671
                         *******************************************9996665499*******...579************************* PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         + +++++dl+ e+ ++k +E++aV +   l ++     + +++ d++++++++l+P vvvv+e ea++ns+sFl+rf+eal +ys+lfd++
  Solyc06g009610.1.1 672 IFMSDMKDLKAESVNLKADETVAVYCYTVLRTMI----CRQDYLDNTMRVIRGLRPSVVVVCEVEANLNSPSFLNRFVEALFFYSVLFDCF 758
                         ****************************999998....77778888********************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                         e  + r++  r+ +E + +g+ i+n+va+egaer+ r+ +l  Wr+ + ++G+ +++lse+   qa+l+l++++ +    v+++ ++l+ g
  Solyc06g009610.1.1 759 EDCMDRDNLVRKRIEVFHIGEGIRNMVAAEGAERFTRNVKLDVWRAYFARFGMVEMELSESSRYQANLILKQFShGSSCIVQKDGKALLVG 849
                         **************************************************************************777788999999999** PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+ p+ svS W+
  Solyc06g009610.1.1 850 WKGTPIESVSIWK 862
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.337468841IPR005202Transcription factor GRAS
PfamPF035143.2E-90494862IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 865 aa     Download sequence    Send to blast
MGSSSKFYVS VSKDYVVNML RESFQCLTII LLSLLLPLSF IVLARLSVTR YLIATSDYTE  60
PNTLLVKLFL YANPIFLRLL TPLVTISALT QCLTGRTLTD HIMISKSHLY MSWLILFTFQ  120
ICVSIGIEGS IAVGIDGSTS FSHQRLYLLT RSMFFMGLHE TTLFWSKKVV KPVVDDTIFG  180
VEKEDRYVEK VAMAMSFGIL WWCKLGDEVE SLVVVAEMKR DLFGSVGLVD FVGWWLYYVT  240
VAIGMVKVVK GLIWLNFVLF CGNMVVGSDN AGSCTRNDEK MDQIPIPTID FSVFQDGHNH  300
VQECGRNELI NNGAVDPWFE LDSEDLDSLY TVFDLKYQDN TADKQVQSLE DQQQSISDHW  360
TQSDDSSNMD LPLQFIQIKT TPEASDGIQP QEPRLDNFHG EKTNSISLAS LELLNNCGRL  420
FKKPSEENLS NVLLSNEARV SNISKLSTEE ILRVAGERYI QYSTQRVDGL SMFIHPYASS  480
LSGLSIEETK DMELVHLLLA AAEEVDQQQF HLASQSIAHC LWKASATGNP IQRLCFYFGE  540
ALQERIDREI GRSPCFERKL RFLSTLALGN TPESLTCHTE IPFSQVMQFA GNQAIVEYVK  600
GATKIHLVDF NIRSGIQWTG LMQALSERRN CPIELLKITA IGHQEKQKIE ETGKRLQSFA  660
NSLNLPFSFD MIFMSDMKDL KAESVNLKAD ETVAVYCYTV LRTMICRQDY LDNTMRVIRG  720
LRPSVVVVCE VEANLNSPSF LNRFVEALFF YSVLFDCFED CMDRDNLVRK RIEVFHIGEG  780
IRNMVAAEGA ERFTRNVKLD VWRAYFARFG MVEMELSESS RYQANLILKQ FSHGSSCIVQ  840
KDGKALLVGW KGTPIESVSI WKFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-4751286221375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015078169.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLK4C3Z10.0K4C3Z1_SOLLC; Uncharacterized protein
STRINGSolyc06g009610.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-50RGA-like 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]