PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g009430.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 224aa    MW: 25987.3 Da    PI: 7.711
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g009430.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.6e-111457548
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        + +Ed +l++ +  +G g+W++ a+  g++R++k+c++rw++yl
  Solyc06g009430.1.1 14 SSDEDSKLIHSISIFGQGRWNSLAHVAGLKRSGKSCRLRWLNYL 57
                        789***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.516161IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-16856IPR009057Homeodomain-like
SMARTSM007171.8E-11959IPR001005SANT/Myb domain
SuperFamilySSF466892.47E-161485IPR009057Homeodomain-like
PfamPF002491.9E-101457IPR001005SANT/Myb domain
CDDcd001676.66E-81457No hitNo description
Gene3DG3DSA:1.10.10.604.7E-55784IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MKQVLTEMKK GPCSSDEDSK LIHSISIFGQ GRWNSLAHVA GLKRSGKSCR LRWLNYLRPN  60
LRRGKITPQE KLLILLLHFR FGNRTKVQKH AKELHCEINS QQFRHLLLYQ WIPSLLAQQI  120
STSSSSSSSS ELIVKENYSL NDINTYPNVN IISSTDSLVR EDSNIWNNLS SFEDRINVPH  180
DISTPSDMTL HYYSSHDEDD QYYFHNYWTS AEMSSLYEMD LWL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g009430.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015078167.11e-130transcription factor MYB78-like
TrEMBLA0A1U8FGX41e-82A0A1U8FGX4_CAPAN; transcription factor MYB108
STRINGSolyc06g009430.1.11e-164(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1539336
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-39myb domain protein 112
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]