PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g005310.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 173aa    MW: 20228.6 Da    PI: 6.2743
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g005310.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.6e-16243548
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        T++E+ l+++++ ++G++ W++Ia +++ gRt++++k++w++++
  Solyc06g005310.2.1  2 TPQEERLILELHSKWGNR-WSRIAMKLP-GRTDNEIKNYWRTHM 43
                        9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.167147IPR017930Myb domain
CDDcd001672.10E-11143No hitNo description
SMARTSM007179.4E-12145IPR001005SANT/Myb domain
SuperFamilySSF466891.25E-12248IPR009057Homeodomain-like
PfamPF002491.5E-14242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-20244IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MTPQEERLIL ELHSKWGNRW SRIAMKLPGR TDNEIKNYWR THMRKKAHDE RKNNASSFSP  60
SSSFSNSSSF SSNSPDVDFT PIKKNNERNF YDTGGLDKKN DGDKMKVYSM DEIWKDIELS  120
QISETMDNIK PIMPSPIWNY CPNTLWMSNE EETKMFPQFY CLDNQDNTFF AG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.255620.0callus
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g005310.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0131104e-43Lycopersicon esculentum clone 114397F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240351.11e-125transcription factor MYB48-like
TrEMBLA0A3Q7GRB81e-124A0A3Q7GRB8_SOLLC; Uncharacterized protein
STRINGSolyc06g005310.2.11e-125(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.27e-35myb domain protein 48
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]