PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g055940.2.1
Common NameLOC101257079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 415aa    MW: 45922.2 Da    PI: 6.5615
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g055940.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.11.9e-33253307155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWtpeLHe Fvea+++LGGsekAtPk +l+lm+v+gLt++hvkSHLQkYR+
  Solyc05g055940.2.1 253 KPRMRWTPELHEVFVEAISKLGGSEKATPKGVLKLMNVEGLTIYHVKSHLQKYRT 307
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.363250310IPR017930Myb domain
SuperFamilySSF466894.12E-18251307IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-31251309IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-25253307IPR006447Myb domain, plants
PfamPF002492.1E-9255306IPR001005SANT/Myb domain
PfamPF143794.4E-24338383IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MNTRRALGIQ RSSETQHSNM GVCGAMSTSL SILPSFEEKH LKVTDSLHVL TEKEQTTNLI  60
SSRAIPSASK SGTVGHLLSS TSGPHKHFHF SSTPSRESRK HNYPFISSEA SAATCQSSLS  120
NIHSTSLDNY PMENSNNSWG EDAYHDCINF STNVPVQNDQ VESLAVVMTS DDQVKRSDWQ  180
DWADQLINDD DVLDSSWSNI LVDINPPDTK FLRASEVHAG QSDTLPPPLP AAAASSGQNY  240
PVGSPSSTAA QTKPRMRWTP ELHEVFVEAI SKLGGSEKAT PKGVLKLMNV EGLTIYHVKS  300
HLQKYRTARY KPESSEGTPE KKTTSVTEMP SLDLITTMGI TEALRMQMEV QKQLHEQLEI  360
QRKLQLRIEE QGKYLEMMFE KTKDIGKDLK VSSSSRTDEH PSPSNKMKHT SPND*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-29253311260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-29253311260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-29253311260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-29253311260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-29253311260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-29253311260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-29253311260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-29253311260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.257490.0flower| fruit| leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g055940.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2056820.0Solanum lycopersicum chromosome 5 clone C05HBa0196G23, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239686.10.0protein PHR1-LIKE 1
RefseqXP_025887060.10.0protein PHR1-LIKE 1
TrEMBLA0A3Q7GN740.0A0A3Q7GN74_SOLLC; Uncharacterized protein
STRINGSolyc05g055940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.22e-87G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]