PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g054510.1.1
Common NameLOC101267120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 299aa    MW: 33706.2 Da    PI: 9.6556
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g054510.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.31.6e-3878138262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++ alkcprC+stntkfCy+nny+lsqPr+fCk+CrryWt GG+lrnvPvGgg+r+n+k+s
  Solyc05g054510.1.1  78 PDVALKCPRCESTNTKFCYFNNYNLSQPRHFCKTCRRYWTIGGTLRNVPVGGGCRRNNKRS 138
                         56789****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3062131IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3181136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.15282136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAFSSIPFYQ DPPNWHHEQG NHHQQQQHLG ITNENSSELS PTVLPPPGAA PGGGGGPVGS  60
TRSGSITERA RLPKITQPDV ALKCPRCEST NTKFCYFNNY NLSQPRHFCK TCRRYWTIGG  120
TLRNVPVGGG CRRNNKRSSS KRSRKSPIRS ERSRNVPIST SNSTNTITTP SHFPPSSTHL  180
SFFNTPFHNF NNFNSTQNCL NFGEIQPHEG DPTFVDQFRH QQMEKFSFFS PLEQPSNLYP  240
IYSEFRINHH DLENVKVEEN KSSTNSTQGM NLQRNNNLGV NQFWTNYNIS STSTSQLL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g054510.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1862900.0Solanum lycopersicum chromosome 5 clone C05HBa0131D04, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010321378.10.0dof zinc finger protein DOF3.6
TrEMBLA0A3Q7GMH20.0A0A3Q7GMH2_SOLLC; Uncharacterized protein
STRINGSolyc05g054510.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.16e-37DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]