PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g053420.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 473aa    MW: 54260.3 Da    PI: 6.5107
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g053420.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS276.48.8e-851004701374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl....fs 85 
                         lve Ll+ Ae v ++++ +a+++L++  +  +s++g+++qRl+ yf +AL++r+ r ++  ++k  ++++   ++ +++l+ l+l     +
  Solyc05g053420.1.1 100 LVENLLASAEKVGQEQFDRARRILNEFCDKlCSNTGNAVQRLVYYFSQALHERIDReTGRDTSKGNEMKRLV-QHIEHSLMNLNLtmiaAH 189
                         5789*********************987666*************************6666666666555554.444444444444455688 PP

                GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                         +  P+ ++s+++a qaI + v ++++vHiiD+ i+ GlQW  L+qaL s   +  +l+iT++     + k+++ee +erL +fA++l++pf
  Solyc05g053420.1.1 190 QNIPLSQVSQFAAVQAIIDHVGESKKVHIIDLKIGSGLQWTILMQALVSH--QIKHLKITALCT---NLKHKIEEARERLMDFAKSLNLPF 275
                         999**********************************************7..556*******99...46999******************* PP

                GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                         +fn++++k++++l+ e+++++ +E++a+  ++ l+ +l+++ +l+s    +++++k+++P+ ++vve ea+hns+ F++rf+eal +y a+
  Solyc05g053420.1.1 276 SFNIVMVKDMTELKKEDFEIDDDESIAIFAQYILMWMLARPDKLDS----LMRVIKGINPRALIVVEVEANHNSPVFVDRFVEALFFYGAF 362
                         **************************************77777777....***************************************** PP

                GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgs 357
                         fdsle  + +++++r+  E e l++ i+++va+eg+er+ rh ++  Wr+ + +  +++++ls +   qa+l+l++++ +   ++e ++++
  Solyc05g053420.1.1 363 FDSLEDCMKNDERNRTATELEHLSQGIRSIVATEGEERTIRHVKVDVWRAFFARYRMEEMELSMSSLYQANLVLKNFAcGSCCTLEMNKNC 453
                         ******************************************************************************9999********* PP

                GRAS 358 lvlgWkdrpLvsvSaWr 374
                         l++gWk+ pL s+SaW+
  Solyc05g053420.1.1 454 LLIGWKGTPLSSLSAWK 470
                         ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.19874449IPR005202Transcription factor GRAS
PfamPF035143.0E-82100470IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MCDHSHQQSP LPSSFKILKD YDTTRFMKRS KTEQNIIVSA ECIKENNGSM LSTDEILRLG  60
AERFIQSFTL RGDQEPYMFN HPFASSLLDL HEEDTRNVSL VENLLASAEK VGQEQFDRAR  120
RILNEFCDKL CSNTGNAVQR LVYYFSQALH ERIDRETGRD TSKGNEMKRL VQHIEHSLMN  180
LNLTMIAAHQ NIPLSQVSQF AAVQAIIDHV GESKKVHIID LKIGSGLQWT ILMQALVSHQ  240
IKHLKITALC TNLKHKIEEA RERLMDFAKS LNLPFSFNIV MVKDMTELKK EDFEIDDDES  300
IAIFAQYILM WMLARPDKLD SLMRVIKGIN PRALIVVEVE ANHNSPVFVD RFVEALFFYG  360
AFFDSLEDCM KNDERNRTAT ELEHLSQGIR SIVATEGEER TIRHVKVDVW RAFFARYRME  420
EMELSMSSLY QANLVLKNFA CGSCCTLEMN KNCLLIGWKG TPLSSLSAWK FS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-4013147033375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010321603.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLK4C2220.0K4C222_SOLLC; Uncharacterized protein
STRINGSolyc05g053420.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.18e-57RGA-like 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]