PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g049860.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 102aa    MW: 11854.5 Da    PI: 10.8325
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g049860.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like46.77.1e-151061356
             G2-like  3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                        r++Wtp+  ++F ea+++LG  ekAt   ile m+v+ Lt+++v   LQ+YR++
  Solyc05g049860.1.1 10 RIKWTPNVNKKFNEAIRRLG--EKATAIPILEYMNVPQLTRKQVENRLQQYRVH 61
                        99*****************6..5566666***********************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-15661IPR009057Homeodomain-like
SuperFamilySSF466891.7E-10762IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-121062IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MEERKERRLR IKWTPNVNKK FNEAIRRLGE KATAIPILEY MNVPQLTRKQ VENRLQQYRV  60
HQLAQHASSS SSLVLANPPN VLNSHDELQH TCNNTFFSST R*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g049860.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019069539.15e-70putative two-component response regulator ARR20 isoform X1
TrEMBLA0A3Q7HED41e-34A0A3Q7HED4_SOLLC; Uncharacterized protein
STRINGSolyc05g049860.1.12e-69(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2809322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.33e-10myb-related protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]