PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g046040.1.1
Common NameLOC101255001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 420aa    MW: 46262.6 Da    PI: 4.7276
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g046040.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box231.6e-07342437
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                        + C++++e ++  +C++++  lC +C ++ H+       H
  Solyc05g046040.1.1  3 PLCDLCGEVRAVVYCKSDSARLCLQCDDYVHSPnlisrrH 42
                        68******99*******************99425555555 PP

2zf-B_box171.2e-054572330
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedCl 30
                          +C+++++++ +  C d    lCe C 
  Solyc05g046040.1.1 45 SFICDKCNSQPSIVRCMDEAISLCERCD 72
                        679************************7 PP

3CCT62.99.8e-22363406144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R +a++RY+eK+ktR F K+irY+sRKa+A++R RvKGrFvk+ 
  Solyc05g046040.1.1 363 RHEAKMRYNEKKKTRTFGKQIRYASRKARADTRRRVKGRFVKAG 406
                         899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.072147IPR000315B-box-type zinc finger
SMARTSM003361.4E-8147IPR000315B-box-type zinc finger
CDDcd000212.40E-7347No hitNo description
PfamPF062031.1E-16363405IPR010402CCT domain
PROSITE profilePS5101714.624363405IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MDPLCDLCGE VRAVVYCKSD SARLCLQCDD YVHSPNLISR RHSRSFICDK CNSQPSIVRC  60
MDEAISLCER CDWDGNGCIG TGHRLKKLNP YTGCPSPDEF TKMLSQVLEM PIGTDTNFGS  120
FGNSLGSSLS INENNSSLEN KVNEDSFVSS KLLASNYKFE AWSIPPEPNY LNSYQIDLAP  180
FSEGSGLSKQ DCPIKDLGLQ EGDDLSKGVD FDDVTLDFNC SYEILPDSRQ TGFSDENKEL  240
DCLVMEKNSS VTGSNNVETS HEATSSVQQE YMGLQSSQIS AAASSTNLLQ TMSANANCML  300
MNSTCNGSIG ALPFLPAPIH PSMSLSLSNI TGESCAEQDC GLSPGFLNEA PWDLSLENCP  360
QKRHEAKMRY NEKKKTRTFG KQIRYASRKA RADTRRRVKG RFVKAGEAYD YDPSETRDF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g046040.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327010.0Solanum lycopersicum chromosome 05 clone C05HBa0031K11, complete sequence
GenBankAC2472930.0Solanum lycopersicum strain Heinz 1706 chromosome 5 clone slm-48a1 map 5, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025886990.10.0zinc finger protein CONSTANS-LIKE 12-like isoform X1
RefseqXP_025886991.10.0zinc finger protein CONSTANS-LIKE 12-like isoform X1
TrEMBLA0A3Q7GKX90.0A0A3Q7GKX9_SOLLC; Uncharacterized protein
STRINGSolyc05g046040.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42311726
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.12e-91B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]