PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g024010.2.1
Common NameLOC101254090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 453aa    MW: 49702.8 Da    PI: 7.1669
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g024010.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box201.4e-06639336
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                         r C+ ++++ + l+C+ +   lC  C +  H+ 
  Solyc05g024010.2.1  6 SRPCDFCNQQIAVLYCRADTAKLCLFCDQLVHSA 39
                        678**************************99954 PP

2zf-B_box24.84.6e-084993341
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         ++C++++++++++ C +++  lC++C    H +      H+++p
  Solyc05g024010.2.1 49 SQICDNCGSEPVSIRCDTDKLVLCQECDWDAHGScavsgaHDRSP 93
                        579*************************99994488888888776 PP

3CCT64.24e-22404447144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R +a++RYkeK+ktR+++K+irYesRKa+A++R+RvKGrFvk++
  Solyc05g024010.2.1 404 RGNAMQRYKEKKKTRRYDKHIRYESRKARADTRKRVKGRFVKAN 447
                         7789**************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.0E-10451IPR000315B-box-type zinc finger
PROSITE profilePS501199.456451IPR000315B-box-type zinc finger
CDDcd000217.51E-7739No hitNo description
PROSITE profilePS501199.7124794IPR000315B-box-type zinc finger
PfamPF006437.9E-65093IPR000315B-box-type zinc finger
CDDcd000215.63E-75194No hitNo description
SMARTSM003360.745294IPR000315B-box-type zinc finger
PfamPF062031.7E-16404446IPR010402CCT domain
PROSITE profilePS5101714.912404446IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MSPGESRPCD FCNQQIAVLY CRADTAKLCL FCDQLVHSAN ALSKKHLRSQ ICDNCGSEPV  60
SIRCDTDKLV LCQECDWDAH GSCAVSGAHD RSPVEGFSGC PSASDLASAW GLDIESKKLH  120
QQHTVLEYPS WMSKDAPPSS VLLQDLMVPS AINSAIYSTK QTPTCGKQKQ VIFKQLIELF  180
KRDLADGVGA GAEDLVPKTP NATSDWQGNI NVSIMDGVTQ KPQQQQPQNV PFTSSIMPHN  240
PKDSDQMVER NILWRGNSFD QNTQIWDFNL GQLRSHEQSS SLEADYSESD MACMMKSYGE  300
LIKGTSLATS KVLGLSGINC SVVHDDMTAF SNNSNNRAAS QGPATSESNN LPRIKTSSDL  360
GCVKPKCGGV STDLNFMDQS IVVGGDNTGE ETLKADMELL AKNRGNAMQR YKEKKKTRRY  420
DKHIRYESRK ARADTRKRVK GRFVKANESP DG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.166160.0fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g024010.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239301.10.0zinc finger protein CONSTANS-LIKE 14-like
TrEMBLA0A3Q7GKA90.0A0A3Q7GKA9_SOLLC; Uncharacterized protein
STRINGSolyc05g024010.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67032126
Representative plantOGRP5453813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.11e-100B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]