PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g014260.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 582aa    MW: 65467.1 Da    PI: 6.5997
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g014260.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.71.1e-22198251155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++Wt +LH++Fv+av+q+ G +k  Pk+il+lm+++ Lt+e+v+ HLQkYRl
  Solyc05g014260.2.1 198 KARVVWTVDLHQKFVKAVNQI-GFDKVGPKKILDLMGIPWLTRENVARHLQKYRL 251
                         68*******************.9*******************************8 PP

2Response_reg78.72e-26241321109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ +++l+++l+k  y +v+++  ++eal  l+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + 
  Solyc05g014260.2.1  24 VLVVDDDPTWLKILEKMLKKCSY-QVTTCGLAREALYVLRERKdgFDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKG 112
                         89*********************.***************999999**********************6644.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+ ++el++
  Solyc05g014260.2.1 113 VQHGACDYLLKPIRMKELRN 132
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363926.0E-1421534IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.1E-4421168No hitNo description
SuperFamilySSF521721.37E-3521146IPR011006CheY-like superfamily
SMARTSM004482.2E-3122134IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.423138IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2324133IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.16E-3025138No hitNo description
Gene3DG3DSA:1.10.10.602.1E-25196256IPR009057Homeodomain-like
SuperFamilySSF466891.24E-15196255IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-19198251IPR006447Myb domain, plants
PfamPF002491.3E-7200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MENSKTSVGF SSPRTDTFPA GLRVLVVDDD PTWLKILEKM LKKCSYQVTT CGLAREALYV  60
LRERKDGFDI VISDVNMPDM DGFKLLEHVG LEMDLPVIMM SVDGETSRVM KGVQHGACDY  120
LLKPIRMKEL RNIWQHVLRK KMQEARDIGN HELDQYDEVW ILNGAEILSG KKRKDFENKH  180
DEREMSDSRC VDSSSMKKAR VVWTVDLHQK FVKAVNQIGF DKVGPKKILD LMGIPWLTRE  240
NVARHLQKYR LYLTRLQKED EAKASFIGTK HPDVSSKEIC SSLSLQNSLD ACTDVTNEKY  300
GCVTGDKTIV QNGKSNICES KVKGVVSVPA AEPRSVVEDN FDPQTTGSKI GLNDSFGLVN  360
TNVKSAKVPI PYCSTGEAPQ PQYKQQDFKP HFRSANGLCH QLLPVVSHQI PVDRTQETCF  420
VNHTPSHEER DRHPDTKNRP SFFKTKNEVV GKFSPVESNV NLYQTVSHQQ TNFHTLEQMP  480
STTWRATSHN VVNGPQSSPG NLTLRSGSIV ASVGEEIHGA SIQGECFLAN NDLPNIEQFD  540
YNDPQPISGV PTYLYDTLRF DYEYPIDSLE GNVIDQGLFI I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-16194256163ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.169300.0flower| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO126299830.0
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g014260.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239497.10.0two-component response regulator ORR26 isoform X1
SwissprotQ5N6V81e-126ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLA0A3Q7GFL40.0A0A3Q7GFL4_SOLLC; Two-component response regulator
STRINGSolyc05g014260.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67882433
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-125response regulator 11
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Du L, et al.
    The two-component signal system in rice (Oryza sativa L.): a genome-wide study of cytokinin signal perception and transduction.
    Genomics, 2007. 89(6): p. 697-707
    [PMID:17408920]