PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g013420.1.1
Common NameLOC101265825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 186aa    MW: 20825.3 Da    PI: 9.1312
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g013420.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.1e-123378247
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        grW+++E+  ++ +  + G+g+W++Ia+++  +Rt+ q+ s+ qky
  Solyc05g013420.1.1 33 GRWSEDEQRAFLIGLDKVGKGNWTRIAKEFVPTRTPTQVASHAQKY 78
                        8******************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.7942783IPR017930Myb domain
SuperFamilySSF466897.18E-153084IPR009057Homeodomain-like
SMARTSM007174.0E-103181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-123180IPR009057Homeodomain-like
PfamPF002496.9E-113378IPR001005SANT/Myb domain
CDDcd001672.97E-93479No hitNo description
TIGRFAMsTIGR015577.6E-143482IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MANTIKLFGA EIHVNNVEES TSCCTSRRSS KGGRWSEDEQ RAFLIGLDKV GKGNWTRIAK  60
EFVPTRTPTQ VASHAQKYFD RQKENKVNKH KKRSVFDIDL DEESSNTRLQ LLSKRAYNKK  120
DHKEILNEES PISAMPIRYI LPPNGSYACY EFNFMSISST NATPVVRGAS SQSSSASTDD  180
LDLSL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.244440.0fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g013420.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327030.0Solanum lycopersicum chromosome 05 clone C05HBa0190L02, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239123.11e-138transcription factor KUA1
TrEMBLA0A3Q7H8W61e-136A0A3Q7H8W6_SOLLC; Uncharacterized protein
STRINGSolyc05g013420.1.11e-137(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13677916
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-23MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]